KEGG   Staphylococcus xylosus C2a: SXYL_01241Help
Entry
SXYL_01241        CDS       T03742                                 

Definition
(GenBank) ATP-dependent exonuclease V alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sxo  Staphylococcus xylosus C2a
Pathway
sxo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sxo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SXYL_01241
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sxo03400]
    SXYL_01241
Enzymes [BR:sxo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SXYL_01241
DNA repair and recombination proteins [BR:sxo03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SXYL_01241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 AAA_12 T2SSE Zeta_toxin AAA AAA_22 AAA_18 UvrD_C AAA_14 AAA_16 Rad17 TsaE Mg_chelatase AAA_28 ABC_tran AAA_29 DUF815 NTPase_1 Helicase_RecD DUF3297 5_3_exonuc AAA_17
Motif
Other DBs
NCBI-ProteinID: CEF18625
Position
Chr1:1290544..1292931
Genome map
AA seq 795 aa AA seqDB search
MENPTLFNNSMIKGTVDAILFQNKENFYTVLKVDTIESNETFDSMPTIVGFFPDIAEGDV
YTFKGQVVTHAKYGKQLKAETFEKELPQTKEAIISYLSSDLFKGIGKKTAQSIVNKLGEN
AISDILNDPTILEKVPSLPKKKQKQIAEQIASNQETEQIIIRLHDLGFGPKLAMAIYQAY
LGETLNVVEKKPYQLVYDVKGIGFNKADTLARNVGIQFNDAERLKAGLLYVLEEECIKQG
HTYLPTNNVLEMTQDMLSQPPGELIETQQLEQVLQDLVNDTKLIQQENEVAIPSLYYSEL
KSVQNLYRNFSYTNKLKEIEQSDLLLEIGEIEERNKVTYADSQREALQTAINSKIMLLTG
GPGTGKTTVIKGIVELYAELHGLSLDYDDYQNDDYPVVLGAPTGRASKRLSESTGLEAMT
IHRLIGWNQDTQPEDILDNEISAKLIIIDEMSMVDTWLFHQFLSAVPIDAQVILVGDEDQ
LPSVGPGQVFKDLIDSKVIPRVNLTEVYRQQDGSSIIELAHRMKLGETIDITQRFHDRNF
INCTTEQIPSVVEKVVSSAVNKGYDMSDIQVLAPMYKGSAGIKKLNTVLQDILNPKEQDT
REIEFGDIVFRKGDKVLQLVNRPSDNIFNGDIGVIVGIFWAKENALNKDVLVVDFEGNEI
TFVRQDLMELTHAYCTSIHKSQGSEFPIVIMPMVKQYFRMLQKPILYTGLTRAKQSLVFL
GDPQAFDIGLKTHGQVRMTQLCAFLKAYFNNEEETETADVSKSFDSDIILSEENIFKINP
MINMGEFSPYDFVED
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccctacactatttaacaattcaatgattaaagggaccgttgatgcgatttta
tttcaaaacaaagagaatttttatacggttttaaaagttgatacgattgaatccaatgag
acatttgattcaatgcctacaattgtagggtttttcccagatattgcagaaggtgacgtc
tatacatttaaaggccaagtagttacacatgcaaaatatggcaaacaattaaaggctgaa
acatttgaaaaagagttaccacaaacgaaagaagcaattataagttatttatctagtgat
ctttttaaaggaataggtaaaaaaacagctcaaagtattgtaaataaattaggtgaaaat
gcaattagcgacatattaaatgatccaactatattagaaaaagtacctagtttacctaaa
aagaaacaaaaacaaattgctgaacaaatcgcaagtaatcaagaaacggaacaaataatc
attcgcctccatgatctaggttttgggccaaagttagcaatggctatataccaagcatat
ttaggagaaacacttaacgtagttgaaaagaaaccttatcaacttgtatatgatgtcaaa
ggcatcggttttaataaggcagacacattagcgcgtaatgtcggcattcaatttaacgat
gcagaacgtcttaaagcagggttactttatgtgttagaagaagaatgtataaaacaaggt
catacgtatttacctacgaataatgtactagagatgactcaagatatgctatcacaacca
ccaggtgaactaatagaaacacagcagcttgaacaagttttacaagatttagttaatgac
actaaattaattcaacaagaaaatgaagttgcgattccaagtctatactattcagaattg
aaaagcgttcaaaatttataccgtaatttttcttatacaaataaactaaaagaaattgag
caatctgatttgctgcttgaaataggagaaattgaggaacgcaataaagtgacatatgca
gattctcaaagagaagccttgcaaacagcgattaactctaaaataatgttactgactggt
ggcccaggtacaggaaaaacgactgtcattaaaggaattgttgaactttatgcagagttg
catggtctatcattagattatgacgattatcaaaatgatgattatccagtagttctaggt
gcgccaactggacgtgcatcgaaacgtttgtcagagtcaactggtttagaagctatgacg
atacatcgcttaataggttggaatcaagatacacaaccagaagatattttagataatgaa
atttctgcaaaacttattattattgatgaaatgtctatggttgatacatggttattccat
caatttttgagtgctgtacctattgatgcacaagttatactagtcggtgatgaagatcag
ctgccatctgttggaccaggccaagtatttaaagatttaattgattcaaaagtaattcct
cgtgtaaatttaactgaagtttaccgacaacaagatggttcaagtattatagaattagcg
cataggatgaaactaggagaaactattgatattacacagagatttcatgaccgtaatttt
ataaactgtacaacagaacagataccttcagttgttgaaaaagtggtgtcaagtgcagtg
aataaaggttatgatatgagtgatattcaagtattagctccgatgtataaagggtctgca
ggtattaagaaactaaatacagtattgcaagatatcttgaatcccaaagaacaagatact
agagaaattgagttcggtgatattgtctttagaaaaggtgataaggtattacaactagtt
aaccgaccaagcgataatatatttaatggtgatatcggggtcattgtaggcatcttctgg
gctaaagaaaatgcattaaacaaagatgtattggtagttgattttgaaggtaatgagatt
acatttgttcgtcaagacttaatggagttgacgcatgcctattgtacttcaatccataag
tcacaaggatcagaatttccgatcgtgattatgccaatggttaaacagtactttagaatg
cttcaaaaacctatattatatacaggtttaacacgtgctaaacagtcacttgtgttctta
ggagatccacaagcatttgatattggtctaaagactcacggccaagtgagaatgacacaa
ttgtgtgcttttcttaaagcgtattttaataatgaggaagaaactgaaactgctgatgtc
agtaaatcctttgattcagatattatattgtctgaagaaaatatatttaaaataaatcca
atgattaatatgggtgaattttccccgtatgacttcgttgaagattga

DBGET integrated database retrieval system