KEGG   Staphylococcus xylosus C2a: SXYL_01417Help
Entry
SXYL_01417        CDS       T03742                                 

Gene name
folA
Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
sxo  Staphylococcus xylosus C2a
Pathway
sxo00670  One carbon pool by folate
sxo00790  Folate biosynthesis
sxo01100  Metabolic pathways
Module
sxo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sxo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SXYL_01417 (folA)
   00670 One carbon pool by folate
    SXYL_01417 (folA)
Enzymes [BR:sxo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SXYL_01417 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: CEF18801
UniProt: C6ZDI7
Position
Chr1:1462859..1463344
Genome map
AA seq 161 aa AA seqDB search
MTLSILVAHDQQRVIGVNNQLPWHLPSDLKHVKALTTGNTLVMGRATFDSIGKPLPNRRN
VVLTRNKSFHHEGVDVIHSMDDIYNLPGHVFIFGGQSLFEEMIDKVDDMYITVIEDKYNG
DTFFPPYTFKDWEVESSVKGKIDEKNTIPHTFLHLTRKETS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacactatcaatactagtagctcatgaccaacagcgtgtcatcggggtaaataatcaa
ttaccttggcacttacctagtgatttaaaacatgtaaaagctttaaccacgggcaatacg
cttgtcatgggccgtgcaacattcgattctattgggaagccgcttcctaatagacgtaat
gttgttttaacaaggaataaatcattccatcacgaaggtgtagatgttatacattcaatg
gatgatatttataacttaccagggcatgtattcatttttggtggtcaatctctttttgaa
gaaatgattgataaagttgatgatatgtatatcactgtgatagaggataaatataatggc
gatacatttttcccgccatatacttttaaagattgggaagttgaatcatcagttaagggg
aaaattgatgaaaagaacacaattcctcacacttttttacatttgacgcgtaaggaaact
tcatag

DBGET integrated database retrieval system