KEGG   Staphylococcus xylosus C2a: SXYL_02274Help
Entry
SXYL_02274        CDS       T03742                                 

Gene name
vraB
Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase vraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sxo  Staphylococcus xylosus C2a
Pathway
sxo00071  Fatty acid degradation
sxo00072  Synthesis and degradation of ketone bodies
sxo00280  Valine, leucine and isoleucine degradation
sxo00310  Lysine degradation
sxo00362  Benzoate degradation
sxo00380  Tryptophan metabolism
sxo00620  Pyruvate metabolism
sxo00630  Glyoxylate and dicarboxylate metabolism
sxo00640  Propanoate metabolism
sxo00650  Butanoate metabolism
sxo00900  Terpenoid backbone biosynthesis
sxo01100  Metabolic pathways
sxo01110  Biosynthesis of secondary metabolites
sxo01120  Microbial metabolism in diverse environments
sxo01130  Biosynthesis of antibiotics
sxo01200  Carbon metabolism
sxo01212  Fatty acid metabolism
sxo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sxo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SXYL_02274 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SXYL_02274 (vraB)
   00640 Propanoate metabolism
    SXYL_02274 (vraB)
   00650 Butanoate metabolism
    SXYL_02274 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SXYL_02274 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SXYL_02274 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SXYL_02274 (vraB)
   00310 Lysine degradation
    SXYL_02274 (vraB)
   00380 Tryptophan metabolism
    SXYL_02274 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SXYL_02274 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SXYL_02274 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SXYL_02274 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sxo04147]
    SXYL_02274 (vraB)
Enzymes [BR:sxo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SXYL_02274 (vraB)
Exosome [BR:sxo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SXYL_02274 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CEF19654
Position
Chr1:complement(2318453..2319595)
Genome map
AA seq 380 aa AA seqDB search
MNEAVIVAAKRTPFGKYGGKLKHLEPEALLKPLFEHFNAQYVDIMTEIDDVILGNVIGNG
GNIARKALLEAGLNQNIPGLTLDRQCGSGLEAVIHACRMVQAGAGSIYIAGGVESTSRAP
WKIKRPQSVYDTQLPEFFERASFAPDSQDPSMIQAAENVAQRYNISRNDQDAFAFESHRK
TIMAYKQKQLNQEIISLEVKGKFFNRDESIKERMDERTLNRLKPLLTEGTVTAGNCCMKN
DGAVLLLVMNKAMAEAYGIQEGLTFKDGITVGVDPTLLGIGPVPAINTLLKRNKHTIDEL
DAIELNEAFASQVLASQRELGISLNKLNIYGGAIASGHPYGASGAALVTRLFYMKDYYRT
IATMGIGGGMGNGAIFERWS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagcggttatagtcgcagcgaaacgaacaccatttggtaaatatggtggaaaa
ttaaagcatttagaaccagaagcattattaaaaccgttatttgagcattttaatgcacaa
tatgtagacataatgacagaaattgatgatgtgattttaggtaatgtaataggaaatggt
ggcaatattgctaggaaagctttgctagaagctggattgaatcaaaatattcctggacta
acattagataggcaatgtggttctgggttagaagcagtgatacacgcatgtcgaatggtg
caagcaggtgcggggtccatatatattgctggtggcgttgaaagtacaagtagagcgcca
tggaagattaaaagaccgcaatccgtatatgacacacagttacctgaattttttgaacgt
gcttcttttgcaccagatagccaagatccatcgatgatacaagctgcagaaaatgtagct
caaagatataatatatcaagaaatgatcaggatgcgtttgcatttgaaagtcatagaaag
acgattatggcttataaacaaaagcaacttaatcaggaaattatttcgttagaagtgaag
gggaaattttttaacagagacgaaagtattaaagaaagaatggatgaacgcacattaaat
cgtttgaaaccattgttaactgaaggaacagtcactgcagggaattgttgtatgaagaac
gatggcgcagtattattattagttatgaataaagcaatggctgaagcttatggtatacaa
gagggtttaacttttaaagatggtattacagtgggagttgatcctactttacttggaatt
ggaccagtacctgcaataaacacattacttaagagaaataaacatacaatagatgaatta
gacgctatagaattaaacgaagcatttgcatctcaagtattagcaagtcaaagagagtta
ggtatatcactaaataagttgaatatatatggtggggcaattgcttcagggcatccatat
ggtgcaagtggtgcggcattagttacacgcttgttttatatgaaggattactatagaact
attgcaactatggggattggaggtggcatgggaaatggagcgatatttgaaagatggtca
tga

DBGET integrated database retrieval system