KEGG   Staphylococcus xylosus HKUOPL8: BE24_00660Help
Entry
BE24_00660        CDS       T03248                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sxy  Staphylococcus xylosus HKUOPL8
Pathway
sxy00071  Fatty acid degradation
sxy00072  Synthesis and degradation of ketone bodies
sxy00280  Valine, leucine and isoleucine degradation
sxy00310  Lysine degradation
sxy00362  Benzoate degradation
sxy00380  Tryptophan metabolism
sxy00620  Pyruvate metabolism
sxy00630  Glyoxylate and dicarboxylate metabolism
sxy00640  Propanoate metabolism
sxy00650  Butanoate metabolism
sxy00900  Terpenoid backbone biosynthesis
sxy01100  Metabolic pathways
sxy01110  Biosynthesis of secondary metabolites
sxy01120  Microbial metabolism in diverse environments
sxy01130  Biosynthesis of antibiotics
sxy01200  Carbon metabolism
sxy01212  Fatty acid metabolism
sxy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sxy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BE24_00660
   00630 Glyoxylate and dicarboxylate metabolism
    BE24_00660
   00640 Propanoate metabolism
    BE24_00660
   00650 Butanoate metabolism
    BE24_00660
  Lipid metabolism
   00071 Fatty acid degradation
    BE24_00660
   00072 Synthesis and degradation of ketone bodies
    BE24_00660
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BE24_00660
   00310 Lysine degradation
    BE24_00660
   00380 Tryptophan metabolism
    BE24_00660
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BE24_00660
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BE24_00660
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BE24_00660
Enzymes [BR:sxy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BE24_00660
Exosome [BR:sxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BE24_00660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AID00652
UniProt: A0A2K3XKL4
Position
135704..136846
Genome map
AA seq 380 aa AA seqDB search
MNEAVIVAAKRTPFGKYGGKLKHLEPEALLKPLFEHFNAQYVDIMTEIDDVILGNVIGNG
GNIARKALLEAGLNQNITGLTLDRQCGSGLEAVIHACRMVQAGAGSIYIAGGVESTSRAP
WKIKRPQSVYDTQLPEFFERASFAPDNQDPSMIQAAENVAQRYNISRNDQDAFALESHRK
TIMAYKQKQLNQEIVSLEVKGEIFNRDESIKERMDERTLNRLKPLLTEGTVTAGNCCMKN
DGAVLLLVMNKAMAEAYGIQQGLTFKDGITVGVDPTLLGIGPVPAVNTLLKRNKHTIDEL
DAIELNEAFASQVLASQRELGISLNKLNIYGGAIASGHPYGASGAALVTRLFYMKDYYRT
IATMGIGGGMGNAALFERWS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagcggttatagtcgcagcgaaacgaacaccatttggtaaatatggtggaaaa
ttaaagcatttagaaccagaagcattattaaaaccgttatttgagcattttaatgcacaa
tatgtagacataatgacagaaattgatgatgtgattttaggtaatgtaataggaaacggt
ggcaatattgctaggaaagctttgttagaagctggattgaaccaaaatattactggacta
acattagataggcaatgtggttctgggttagaagcagtgatacacgcatgtcgaatggtt
caagcaggcgcgggatctatatatatagctggtggcgttgaaagtacaagtagagcgcca
tggaagattaaaaggccacaatccgtatatgacacacagttacctgaattttttgaacgt
gcttcttttgcaccagataaccaagatccatcgatgatacaagctgcagagaatgtagcg
caaagatataatatatcaagaaatgatcaggatgcatttgcattagaaagtcatagaaag
acgattatggcttataaacaaaagcaacttaatcaggaaattgtttcgttagaagtgaag
ggggaaatttttaacagagacgaaagtattaaagaaagaatggatgaacgcacattaaat
cgcttgaaaccattgttaactgaaggcacagtcactgcaggaaattgttgtatgaagaac
gatggcgcagtattattattagttatgaataaagcaatggctgaagcttatggtatacaa
cagggtttaacttttaaagatggtattacagtgggagttgatcctacgttacttggaatt
ggaccagttcctgcagtaaacacattacttaagagaaataaacatacaatagatgaatta
gacgctatagaattaaacgaagcatttgcatctcaagtattagcaagtcaaagagagtta
ggtatatcactaaataagttgaatatatatggtggggcaattgcttcagggcatccatat
ggtgcaagtggtgcggcattagttacacgcttgttttatatgaaggattactatagaact
attgcaactatggggattggaggtggcatgggaaatgcggcattatttgaacgatggtca
tga

DBGET integrated database retrieval system