KEGG   Staphylococcus xylosus HKUOPL8: BE24_03045Help
Entry
BE24_03045        CDS       T03248                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
sxy  Staphylococcus xylosus HKUOPL8
Pathway
sxy00471  D-Glutamine and D-glutamate metabolism
sxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sxy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BE24_03045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sxy01011]
    BE24_03045
Enzymes [BR:sxy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BE24_03045
Peptidoglycan biosynthesis and degradation proteins [BR:sxy01011]
 Precursor biosynthesis
  Racemase
   BE24_03045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AID01102
UniProt: A0A418I818
Position
617982..618782
Genome map
AA seq 266 aa AA seqDB search
MDKPIGVIDSGVGGLTVAKEIMRQLPNETIYYLGDIKRCPYGPREGSQVREFTTELAQKL
MAFDIKMLVIACNTATAVALKHLQNILPIPVIGVIEPGARTAIMTTKNNDVLILGTEGTI
KSEAYRHHIKNINPNVEVSGIACPGFVPLVEQMRYQDPTITSIIIHQTLKHWRNSNADTV
ILGCTHYPLLYQPINDYFGGEKVVISSGLETAREVSALLTFSNEHAGYKRQPEHKFFATG
ETEHIELIIEEWLKMKVKVEKIEIQE
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaccgataggtgtaattgactctggagttggtggtttaacagttgctaaagaa
attatgcgtcaacttccaaacgaaacaatatattatttaggtgatattaagcgttgccct
tatggcccgagagagggttcacaggttagggaattcactacagaattagcacagaaatta
atggcatttgatattaaaatgttagttattgcttgtaatacggctacagcagtagcgtta
aaacatctgcaaaacatattgccgatacccgtaattggtgtaatagaacccggtgcaaga
actgcaattatgactactaaaaataatgatgttttaattttaggtacagaaggtacaatt
aaatctgaagcctatagacatcatattaaaaatataaacccaaatgttgaagtatctggg
attgcatgtcctggttttgtacctttagttgaacagatgcgctaccaagaccctacaatc
acaagtattattattcatcaaacattaaagcattggagaaatagtaacgccgatacagtg
attttaggttgtacacactatccattattataccagccaatcaatgattattttggtgga
gaaaaagtagtgatttcttcgggattagaaactgctcgtgaggtaagtgccttactaaca
tttagtaatgaacatgcagggtataaacgacagcctgaacataaattttttgctacagga
gaaactgaacatatagaattaattattgaagaatggttaaaaatgaaagtgaaagttgaa
aaaattgaaatacaagaatag

DBGET integrated database retrieval system