KEGG   Staphylococcus xylosus HKUOPL8: BE24_07515Help
Entry
BE24_07515        CDS       T03248                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sxy  Staphylococcus xylosus HKUOPL8
Pathway
sxy00010  Glycolysis / Gluconeogenesis
sxy00053  Ascorbate and aldarate metabolism
sxy00071  Fatty acid degradation
sxy00280  Valine, leucine and isoleucine degradation
sxy00310  Lysine degradation
sxy00330  Arginine and proline metabolism
sxy00340  Histidine metabolism
sxy00380  Tryptophan metabolism
sxy00410  beta-Alanine metabolism
sxy00561  Glycerolipid metabolism
sxy00620  Pyruvate metabolism
sxy00625  Chloroalkane and chloroalkene degradation
sxy01100  Metabolic pathways
sxy01110  Biosynthesis of secondary metabolites
sxy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BE24_07515
   00053 Ascorbate and aldarate metabolism
    BE24_07515
   00620 Pyruvate metabolism
    BE24_07515
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BE24_07515
   00561 Glycerolipid metabolism
    BE24_07515
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BE24_07515
   00310 Lysine degradation
    BE24_07515
   00330 Arginine and proline metabolism
    BE24_07515
   00340 Histidine metabolism
    BE24_07515
   00380 Tryptophan metabolism
    BE24_07515
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BE24_07515
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BE24_07515
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BE24_07515
Enzymes [BR:sxy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BE24_07515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Mycobact_memb
Motif
Other DBs
NCBI-ProteinID: AID01882
Position
1488247..1489626
Genome map
AA seq 459 aa AA seqDB search
MNSIEQTFHNSTQYFKTHVTKDLKFRRKQLKLLGKSIKNHEAALLEAFQKDLGKNKVEAY
ATEIGFTLKSIKNARKELKNWAKRKQVNTPIYMFPTKSYIIKEPYGTVLIIGPFNYPFQL
LIEPLIGAIAAGNTAILKPSEFTPNVSEVIKRVIEDVFDPEYISICEGDAETTQSLIRLP
FDYIFFTGSEQVGKIVYQAASKNLTPVTLELGGKSPVIIDETANIKVASERISFGKFTNA
GQTCVAPDYILVNRKVKDELIAALKKTITEFYGNNIQESPDFGRIVNHKHFSRLDNLLKV
HHAEIVFGGGSNEDERYIAPTLLDGITFNAKIMEDEIFGPILPIITYDDFDEAIDLIRSK
PKPLSLYLFSEDENATERVLNEISFGGGAINDTLMQLANSNLPFGGVGASGIGQYHGKYS
FDTFSHDKSYIFKSTRLESSLLFPPYKGKFKYIKAFFNK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
ttgaattcaatagagcaaactttccacaatagtactcaatattttaaaacacacgtgact
aaagatttaaaatttagaagaaaacagcttaaacttttgggtaaaagtatcaaaaatcat
gaagccgccttattagaggcctttcaaaaagatttaggtaagaataaagttgaagcttat
gctactgaaattggtttcactttaaaaagtattaaaaatgctcgtaaagaactcaaaaat
tgggctaaaagaaaacaagtcaatacgcctatttatatgtttccaactaaaagctatatc
ataaaagagccttatggcacagttttaataattggaccttttaattatcccttccaatta
ctaattgagccacttattggtgctatagcagctggaaatactgccatactcaaaccttct
gaattcacgccaaacgtttcagaagttattaaacgtgtaatcgaagatgtattcgatcct
gaatacattagtatttgtgaaggtgatgctgaaactacgcaatcattaatccggttacca
tttgattatatctttttcactggtagcgaacaagttggtaaaattgtgtatcaagcagcg
agtaaaaatttaactcctgtaacgttagaacttggcggtaagtctccagtaatcattgat
gaaacagcaaacattaaagttgcaagcgaacgtatcagttttggtaaatttacaaatgct
ggacaaacttgtgttgctcctgactatatacttgtgaatcgtaaagttaaggatgaatta
atcgctgcgcttaaaaaaaccattaccgaattttatggtaataacattcaagaaagccct
gattttggacgtattgtaaaccataaacattttagtcgtttagataatttattaaaggtt
catcatgctgagattgtctttggtggtggatcaaatgaagatgaaaggtacattgctcct
acactgttagatgggattacttttaacgctaaaataatggaagacgaaatttttggtcct
attttaccaattattacgtacgatgatttcgatgaagctattgatttaatacgttccaaa
cctaaaccactaagcttatatttgtttagtgaagatgaaaatgcaacagagcgtgtatta
aatgaaatatcatttggcggtggcgcaattaacgataccttgatgcaattagcaaattca
aacttaccatttggtggtgttggcgcttctggcattggtcaatatcatggtaaatacagt
ttcgatacgtttagccatgacaaatcatatatttttaaatcaactcgacttgaatctagt
ttgttgtttccaccatataaagggaaatttaaatatattaaagctttctttaataagtaa

DBGET integrated database retrieval system