KEGG   Staphylococcus xylosus HKUOPL8: BE24_09930Help
Entry
BE24_09930        CDS       T03248                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sxy  Staphylococcus xylosus HKUOPL8
Pathway
sxy00520  Amino sugar and nucleotide sugar metabolism
sxy01100  Metabolic pathways
sxy01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BE24_09930
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BE24_09930
Enzymes [BR:sxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BE24_09930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AID02322
Position
1958650..1960374
Genome map
AA seq 574 aa AA seqDB search
MVKVNLKTSPYNLDDTQIAWVEETLKDLSNEEKIGQLFFNLFSLEDGKKFHDADLSNKEV
LERYHIGGARYEGGNKVDVQRLLNDLQQNTKVPVLVAANCDSGGNGACKDGTYIASAAQC
EAAQDTKVAYNAGLVSAREASALGVHINFDPCVDILKNWRNTIVNTRSYGTEAQTVIKYS
SAFIDGFNSEHDMITCIKHFPGDGTEERDQHLVLGVNELSTEEWDNSFRKVYQHHIDRGV
QMIMAGHIAQPAYSKKLNSNLEDKDILPATLSKELITDLLKDDMHFNGLVVTDASHMLGM
TAAMRREDYVPLSIAAGCDMFLFFNDLEEDYQFMLNGYNNGIITDERLDDAVRRILGLKA
QLNLHKKQVDGTIIRAKEDLQVIGCQEHLDMRAEAAYLGITLVKNTLDQLPIRPETHKNI
RLYVIEGEKDGIYKSANNVPEDIIKELESRGFNVTLNDGSTRVKGKTLSYREDVDAALVF
ANIIGYAAENNYRIKWGTAMSNEIPWYVHEVPTVFVSLNFTTHLHDATMVKAYINAYHSN
PESIKQTVDKIMGLSTFKGSYNDLVWTDKWQAKL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagtaaacctaaaaacatcaccttataatttagacgacacacaaattgcttgg
gttgaagaaacactaaaagatttatcaaatgaagaaaaaattggccaactctttttcaat
ttattttcattagaagatggaaaaaaattccacgatgcagatttgagtaataaagaagtt
ttagaacgttatcatattggtggcgcacgttacgaaggcggtaataaagttgatgtacaa
agattactcaatgacttacaacaaaatacaaaggttcctgtacttgttgcagctaactgt
gattctggaggtaatggcgcatgtaaagatgggacttatattgcgagtgcagcacaatgt
gaagctgcacaagatactaaggtcgcatacaatgctggactcgtttctgcacgtgaggct
tcagcattaggtgttcatatcaattttgatccttgtgttgatattcttaagaactggcgc
aatactatcgtaaatacacgctcatacggtacagaggcacaaacagttatcaaatattct
agtgcttttattgatggtttcaattcagaacatgacatgattacatgtattaaacatttc
cctggagatggtacagaagaacgtgatcaacatttagtgttaggtgtaaacgaattatct
acagaagaatgggacaatagtttccgtaaagtttatcaacatcatattgatcgtggtgta
caaatgattatggctggtcatatcgcacaacctgcttattctaaaaagttaaactcaaac
ctagaagataaagatattttgccagcaacattatcaaaagaacttatcactgatttactt
aaagacgatatgcattttaatggcttagtcgttacagatgctagtcatatgttaggaatg
actgctgctatgcgtcgtgaagattacgtacctctttcaattgctgctggatgtgatatg
ttcctattcttcaatgatttagaagaagattatcaatttatgctaaatggatataataat
ggtatcatcacagatgaacgtttagatgatgctgttcgtcgtatcttaggacttaaagca
caattgaatttacacaaaaaacaagtagatggaacaatcattcgcgctaaagaagacttg
caagttatcggctgtcaagaacatttagatatgcgtgctgaagctgcttatttaggtatt
acactagtaaaaaacactttagatcaattaccgattcgtccagaaacacataaaaacatt
cgtctttatgtaattgaaggtgaaaaagatggcatttataaatctgctaataatgtgcct
gaagacattattaaagaacttgaatcaagaggttttaatgttactttaaatgatggttct
acacgtgttaaaggtaaaactttatcttatcgtgaggacgttgatgcagcacttgtcttt
gctaatattattggttacgctgctgaaaataactaccgaatcaaatggggtactgctatg
agcaatgaaatcccttggtatgtacatgaagtgccaacggtatttgtttctttaaacttc
acaacacacttacatgatgcaacgatggtgaaagcttatataaacgcttatcattctaac
cctgaaagtattaaacaaacggtcgataaaattatgggattgagcacttttaaaggttct
tataacgatttggtttggactgataaatggcaagccaaattataa

DBGET integrated database retrieval system