KEGG   Staphylococcus xylosus HKUOPL8: BE24_10335Help
Entry
BE24_10335        CDS       T03248                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sxy  Staphylococcus xylosus HKUOPL8
Pathway
sxy00900  Terpenoid backbone biosynthesis
sxy01110  Biosynthesis of secondary metabolites
sxy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sxy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BE24_10335
Enzymes [BR:sxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     BE24_10335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red UPF0180
Motif
Other DBs
NCBI-ProteinID: AID02398
Position
complement(2053504..2054787)
Genome map
AA seq 427 aa AA seqDB search
MEPLGKTFRHLSRTEKLEELVIKGWLSEENKNVLLNNPLISEEIANSLIENVIGQGTLPV
GLLPEINVDGKSYVVPMMVEEPSVVAAASYGAKLVNQTGGFKVIASERLMIGQIVFDSVT
NTAVLEEQLQQLEVQMKRIADEVYPSIIERGGGFRKIEIDTFPNEGLVSLKIYVDTKDAM
GANMLNTILEGITAYLKNELEHVDILMSILSNHATASVVKVQGEISVDALSKGGRDGKDV
AKRMERASVLAQVDIHRAATHNKGVMNGIHAVVLATGNDTRGAEATAHAYASKDGQYRGL
ATWHYNEEKQVLVGTIEVPMTLATVGGGTKVLPIAKASLELMNVDSAQELGHVVAAVGLA
QNFAACRALVSEGIQQGHMSLQYKSLAIVVGAQGEEIAQVAERLKTQDRANTAVAQQLLE
ELRLQKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaaccattaggtaagacgtttcgtcatttgtctagaacagaaaagttagaggagtta
gtaattaaaggttggttatctgaagaaaataaaaatgtgttactcaataatcctttaatt
tcggaagagattgcgaatagtcttatagaaaacgtcattggacaagggacattacctgta
ggattattacctgaaatcaacgtagatggtaaatcatatgttgtaccaatgatggtagaa
gaaccttcagtagttgcagcagctagttacggagcaaagcttgtaaatcaaactggcggc
tttaaagttattgctagtgaacgtttaatgattggtcaaattgtgtttgatagtgtgaca
aatacagcagttttagaggagcaacttcaacaacttgaagtgcagatgaaacgtattgca
gatgaagtgtatccttcaataattgagcgtggtggcggctttcgtaaaatagagatagat
acattcccaaatgaaggcttagtgtcattaaaaatctatgtagatactaaagatgcaatg
ggtgcaaatatgttgaataccattttagaaggtatcacagcgtatttaaaaaatgaattg
gaacatgttgatatattgatgagtattttatctaatcacgctactgcatcggttgttaaa
gtgcagggggaaatctcagttgatgcattatcaaaaggcggtcgtgatggtaaagatgtt
gctaaaagaatggaacgcgcctctgtattagctcaagttgatatacatcgagcggcaaca
cataataaaggtgtgatgaatggtattcacgctgtagtgctggcgacaggtaatgatact
cgtggtgctgaagcgacagcacatgcatatgcaagtaaagatggtcaatatcgtggtcta
gctacgtggcattataatgaagaaaaacaagtgcttgtagggacaattgaggtgcctatg
acattggctactgtgggtggcggtacaaaagttttaccaatcgcaaaagcctcgttagaa
ttaatgaacgttgattctgcacaagaattaggtcatgttgtcgctgccgtaggattagct
caaaattttgctgcatgtcgtgccttagtttctgaaggtattcaacaaggtcatatgagt
ttacaatataaatcattagcaattgtagtaggtgcgcaaggtgaagaaattgctcaagta
gcagaacgtttaaaaacacaagaccgtgccaatacagcagttgctcaacaactcttagaa
gagttaagattacaaaaacaataa

DBGET integrated database retrieval system