KEGG   Sphingobium yanoikuyae: A6768_13695Help
Entry
A6768_13695       CDS       T05170                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sya  Sphingobium yanoikuyae
Pathway
sya00620  Pyruvate metabolism
sya00630  Glyoxylate and dicarboxylate metabolism
sya01100  Metabolic pathways
sya01110  Biosynthesis of secondary metabolites
sya01120  Microbial metabolism in diverse environments
sya01200  Carbon metabolism
Module
sya_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6768_13695
   00630 Glyoxylate and dicarboxylate metabolism
    A6768_13695
Enzymes [BR:sya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A6768_13695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ATI80924
UniProt: A0A291N0I7
Position
complement(2977464..2979578)
Genome map
AA seq 704 aa AA seqDB search
MTDRMTDRAGLKVAATLADFIEQRALPGTGIDADAFWAGTADILARFTPDNAALLRTRDE
LQTQIDAWHQVRRGQAHNAAAYQAFLREIGYLVEEPAPFEIGSGNVDAEVARMAGPQLVV
PILNARFLLNAANARWGSLYDALYGTDAIAGAASGKGYDAARGAQVIAWAKAFLDDAVPL
ATGRWADLAGGEIVLADPAQFVGTSAKGRLFRHNGLHIEVVFDPAHPIGATDPAGISDVI
LESALTTICDLEDSVAAVDAADKVTAYANWLGLMQGDLTETFEKGGKSMTRALNPDRAYV
APDGSAFTLPGRSLLFVRNVGHLMTTPAIALPDGQDAPEGIIDGIVTSLIALHDLAKADG
NSRAGSVYIVKPKMHGPQEAAFTNRLFDAIEDMLGMARHTIKVGVMDEERRTSANLAACI
HAVRDRIVFINTGFLDRTGDEMHTSMQAGPMIRKGEMKASDWITAYEDRNVQIGLACGLS
GRAQIGKGMWAAPDRMADMLEQKIGHPQSGANTAWVPSPTAATLHATHYHRVDVFARQEE
RKAEGIASLDKLLTIPVAVGRNFSEQEIAQELDNNAQGILGYVVRWIDQGVGCSKVPDIH
DVGLMEDRATLRISSQHMANWLLHGVCTAEQVDAALTRMAAKVDAQNEADPLYQPMSGRE
GESLAFQAARALVFEGVEQPNGYTEPLLHAYRARAKAEEVLEIA
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcatgaccgaccgcgccggcctgaaggtcgccgcaacgctggccgacttc
atcgagcagcgcgcgctgccgggcacgggcattgatgccgacgccttctgggcgggcact
gccgacatattggcgcgtttcacccccgacaatgcggcgctgctgcgcacgcgcgatgag
ctgcagacgcagatcgatgcctggcatcaggtgcgccggggacaggcgcacaacgccgcc
gcctatcaggccttcctgcgcgagatcggctatctggtcgaggaaccggcgcctttcgag
atcggcagcgggaatgtcgacgctgaagtcgcccgcatggccgggccgcagctggtcgtc
ccgatcctcaacgcccgtttcctgctcaacgccgccaatgcgcgctggggcagcctctat
gacgcgctctatggcaccgatgccattgcgggcgcggcttcgggcaagggctatgatgcg
gcgcgcggggcgcaggtcatcgcctgggctaaggcgtttctggacgatgccgttccgctg
gcgacgggacgctgggccgatctggcgggcggagaaatcgtcctggccgatccggcgcag
tttgtcggcaccagcgcgaagggcaggctgttccgccataatggcctgcatatcgaggtc
gtctttgacccggcccacccgatcggtgcgaccgacccggccggcatatccgacgtcatc
ctggaatccgcgctgaccaccatctgcgacctggaagattcggtcgcggcggtcgatgcg
gcggacaaggttaccgcctatgccaactggctggggctgatgcagggcgacctgaccgag
acgttcgagaagggcgggaagtcgatgactcgcgcgcttaatcctgatcgcgcttatgtt
gcgcccgatggcagcgccttcacgctgccgggccgcagcctgttgttcgtccgcaatgtc
ggtcatctgatgaccacgccggcgatcgcgctgcctgatgggcaggatgcgcccgagggg
atcatcgatggcatcgtcaccagcttgatcgcgctgcatgatctggccaaggcggatggc
aacagccgcgcgggcagcgtctatatcgtcaagcccaagatgcacgggccgcaggaagcg
gccttcaccaaccgcctgttcgacgcgatcgaggatatgctgggcatggcgcgccacacg
atcaaggtcggggtgatggatgaggagcggcgcacgtcggccaatctggcggcctgcatc
catgccgtccgcgaccggatcgtctttatcaataccggcttcctcgatcgcaccggggac
gagatgcacacgtcgatgcaggccgggccgatgatccgcaagggcgagatgaaggcgagc
gactggatcacggcctatgaggatcgcaatgtccagatcggcctcgcctgcggcctgtcg
ggccgggcgcagatcggcaagggcatgtgggcggcgcccgatcgcatggccgacatgctg
gagcagaagatcggccatccgcagagtggcgccaacaccgcctgggttccgtccccgacg
gcggcgacgctgcacgcgacccattatcatcgcgttgacgtctttgcccgtcaggaagaa
cgcaaggccgagggcattgcgtcgctcgacaagttgctgaccattcccgtcgcggtcggc
cgcaatttctccgaacaagagatcgcgcaggaactggacaataatgcgcagggcatattg
ggctatgtcgtccgctggatcgaccagggcgtcggctgttccaaggtgcccgatatccat
gatgtcggcctgatggaggatcgcgcgaccttgcgcatttcctcgcagcatatggccaac
tggctgctgcacggcgtctgcaccgcggaacaggttgatgctgcgctgacccgcatggcg
gccaaggtcgatgcgcagaatgaagccgatccgctctatcagccgatgagcgggcgcgag
ggcgagagcctggccttccaggcggcgcgcgccctggtgttcgagggtgtcgagcagccc
aatggctataccgagccgttgctgcacgcctatcgcgcccgtgccaaggcggaggaagtc
ctcgagatagcgtaa

DBGET integrated database retrieval system