KEGG   Sphingobium yanoikuyae: A6768_14840Help
Entry
A6768_14840       CDS       T05170                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
sya  Sphingobium yanoikuyae
Pathway
sya00790  Folate biosynthesis
sya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sya00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A6768_14840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sya04147]
    A6768_14840
Enzymes [BR:sya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     A6768_14840
Exosome [BR:sya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A6768_14840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ATI81132
UniProt: A0A291N1B3
Position
complement(3223530..3223820)
Genome map
AA seq 96 aa AA seqDB search
MLARLNETERAIALADLPEWTAVAEPDGIARSFTFPDFVAAFGFMTRVALLAEKADHHPE
WSNVYNRVEITLTTHDAGGLSQRDIDLAKAIEALLR
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccagactgaacgaaacggaacgggcgatcgcgctggcggatttgcccgaatgg
acggcggtcgccgaaccggacgggattgcgcgcagcttcacctttcccgacttcgtcgcc
gccttcggcttcatgacgcgggtggcgctgctggcggaaaaggcggaccatcatcccgaa
tggtcgaacgtctataaccgggtcgaaatcacgctcaccacccatgatgccggcggcctg
tcgcaacgggacatcgatctggcgaaggcgatcgaggcgctgttgcgctga

DBGET integrated database retrieval system