KEGG   Sphingobium yanoikuyae: A6768_15035Help
Entry
A6768_15035       CDS       T05170                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
sya  Sphingobium yanoikuyae
Pathway
sya00471  D-Glutamine and D-glutamate metabolism
sya00550  Peptidoglycan biosynthesis
sya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    A6768_15035 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A6768_15035 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sya01011]
    A6768_15035 (murD)
Enzymes [BR:sya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     A6768_15035 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:sya01011]
 Precursor biosynthesis
  Amino acid ligase
   A6768_15035 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C adh_short
Motif
Other DBs
NCBI-ProteinID: ATI81170
UniProt: A0A291N1X8
Position
complement(3265455..3266768)
Genome map
AA seq 437 aa AA seqDB search
MIVSQAFKGKTYAVLGLARSGLATVETLVASGARVVAWDSREEARAAVADKAELGDPMEI
DLAGFDGIVVSPGVPLNKHPIAMRAKIAGVPIIGDIELFALARPTLPPHKVVGITGTNGK
STTTALIHHIIEQAGFPARMGGNIGLPILGQEPLEPNLHGVGIYVLELSSYQIDLTHSLD
CDVAVLLNITPDHLDRYNGFAGYVASKARLFAMQSADHVAVIATEDEPSRGIAASAPAQL
REVKAADIDPEAQLGWPSLQGPHNAQNAAVAIAVGQALGIDDATIMAALVSYASLPHRMQ
AVGTHNGVLYVNDSKATNAASTAPALGAWPARDGKPRIHWILGGVAKSDNLDECAPYYGN
IAHAYTIGEAGHMFADLLRPHMAVDDSEMLSAAVRRAARVAQPGDVVLLSPACASFDQFR
DFEARGDAFAAAVNALE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtttcgcaggccttcaaggggaagacctacgccgtattggggctggcccgttcg
gggctggccacggtcgagacgctcgtcgccagcggcgcgcgcgtcgtcgcctgggacagt
cgcgaggaagcgcgggcggccgtcgccgacaaggcagaactgggcgacccgatggagatc
gacctggccggtttcgacggcatcgtcgtgtcgccgggcgtgccgctcaacaagcatccg
atcgcgatgcgcgcgaagatcgccggcgtgccgatcatcggcgacatcgaactgttcgcg
ctcgcccggccgacgctgccgccgcacaaggtcgtcggcatcaccggcaccaacggcaag
tcgaccacgaccgcgctgatccatcacatcatcgaacaggccggcttcccggcgcggatg
ggcggcaatatcggcctgccgatcctggggcaggagccgctggagccgaacctgcatggc
gtgggcatctatgtgctggaactgtccagctaccagatcgaccttacccatagcctcgac
tgcgatgtcgccgtgctgctcaacatcacgcccgaccatctcgatcgctacaacggtttc
gccggctatgtcgcgtcgaaggcgcggctgttcgccatgcagtcggccgaccatgtcgcg
gtgatcgcgaccgaggatgagccgagccggggcattgccgcatcggccccggcgcagctg
cgcgaagtgaaggccgccgatatcgatccggaggctcagcttggctggccgtcgctgcag
gggccgcacaatgcccagaatgccgccgttgcgatcgcggtcggccaggcattgggcatc
gatgacgcgaccatcatggccgcgctcgtcagctatgccagcctgccgcatcggatgcag
gcggtgggaacgcataatggcgtgctctatgtcaatgacagcaaggcgaccaacgccgcc
tcgaccgcgccggcgctgggcgcctggccggccagggatggcaagccgcgcatccactgg
attttgggcggcgtcgccaagtccgacaatctggacgaatgcgcgccttattatggcaat
atcgcccatgcctacaccatcggtgaggcggggcacatgtttgccgacctgttgcggccg
cacatggcggtcgatgacagcgagatgctgagcgccgccgtccgtcgcgccgcgcgtgtc
gcccagccgggcgatgtcgtgctgctgtcgccggcctgcgccagtttcgaccagttccgg
gatttcgaggcgcgcggcgatgcctttgccgcggccgtgaacgcgctggaatag

DBGET integrated database retrieval system