KEGG   Sphingobium yanoikuyae: A6768_23485Help
Entry
A6768_23485       CDS       T05170                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
sya  Sphingobium yanoikuyae
Pathway
sya00860  Porphyrin and chlorophyll metabolism
sya01100  Metabolic pathways
Module
sya_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:sya00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A6768_23485
Enzymes [BR:sya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     A6768_23485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ATI82666
UniProt: A0A084EEE8
Position
5072810..5073379
Genome map
AA seq 189 aa AA seqDB search
MMGMPLHLLRHGAPETPGLLLGRTDSVPTRAGIDACLAQAEGLEIEMIVTSDLQRARQAA
TAIGERAGLPVWVDPRWRELDFGIWDGLAPADVDPEALARFWQDPDGFAPPGSEGWTALL
GRIADAVEDLPRVPTLVLTHGGAMRAALAHLCGFSVQQSWSFGLPYAALLSLERWTGEPP
LARITGLRP
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcatgccgctccatctgctgcggcatggcgcgcccgagacgcccggcctgttg
ctggggcggaccgacagcgtgccgacgcgcgcgggcatcgacgcctgtctggcgcaggcg
gaggggttggagatcgagatgatcgtgacgtccgacctgcagcgcgcccggcaggcggcg
acggcgatcggcgagcgcgccggcttgccggtgtgggtcgatccgcgctggcgggaactg
gatttcggcatctgggatggtctggccccggccgatgtcgatcccgaggcgctcgcccgt
ttctggcaggatcccgatggcttcgcgccgccgggcagcgagggatggacggcattgctg
gggcggatcgccgatgcggttgaggatctgccgcgcgtgcccacattggtgctgacccat
ggcggggcgatgcgcgcggcgctggcccatttgtgcgggtttagcgtccagcagagctgg
agcttcggcctgccctatgccgccttgctgtcgctggaacgctggaccggggagccgccg
ctcgcccgcatcacgggcctgcgcccatga

DBGET integrated database retrieval system