KEGG   Sphingobium yanoikuyae: A6768_25285Help
Entry
A6768_25285       CDS       T05170                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sya  Sphingobium yanoikuyae
Pathway
sya00970  Aminoacyl-tRNA biosynthesis
sya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sya00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A6768_25285
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sya03029]
    A6768_25285
Enzymes [BR:sya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A6768_25285
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A6768_25285
Mitochondrial biogenesis [BR:sya03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A6768_25285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase TAT_signal
Motif
Other DBs
NCBI-ProteinID: ATI82988
UniProt: A0A291N7E8
Position
5426788..5428167
Genome map
AA seq 459 aa AA seqDB search
MEHGGVTRRTILHGAGGAMALGTVGAPAIAKSRPSRERLEAALARIADPVGEGRRTYLTL
YVDSARAAADAADARAASPLSPIDGAIVSIKDLFDVAGEPTRAGSLILADAPPATADAPV
VARLKQAGAVIVGKTNMVEFAFSGVGANPHYGTPGNPADRTRVPGGSTSGGGVAVADQMC
EIAIGTDTGGSCRIPAALCGVVGYKPTKARVPTDGAFPLSPTLDSIGPIATSVDACFRTD
AILAGEAPRRLDLAPLKGLRAGIPQGLPLADLDATVAARFADALARLGQAGMTLSDEVFP
QFDAMQALQSPVPIASVEAYAIHRDRIATRAQDFDPIVLARMQAGRDVTPERHRQMLVER
AALVRSMDARLTGLDILVLPTTAIVAPTKAEVANADAFVARNRLLLRNTGLGNSFDLCAI
SLPLPREGGLPVGLMLMARAGQDQRLFAIAAAVEKLLAV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggagcatggcggcgtgacgcgacggacgatcctgcacggcgccggtggcgccatggcg
ctcggcaccgtcggcgcgccggccatcgccaaatcccgcccgtcacgcgagcgtctggaa
gcagcgctcgcgcgcatcgccgacccggtgggagagggccggcgcacctatctcaccctc
tatgtggacagcgcgcgggcggcggcggacgcggccgatgcccgtgccgcttcgccgctc
tcgccgatcgacggcgccatcgtcagcatcaaggatctgttcgatgtcgcgggcgagccg
acccgcgccggttcgctgatcctggccgatgccccgcccgccaccgcagatgcgccggtc
gttgcccggctgaagcaggccggcgcggtgattgtcggcaagaccaacatggtcgaattc
gccttttccggcgtcggcgccaatccccattatggcacgccgggcaatccggccgaccgg
acccgcgtgcccggcggatcgaccagcggcggcggcgtcgcggtggccgatcagatgtgc
gagatcgccatcggcaccgataccggcggttcctgccgcatccccgccgcgctgtgcggt
gtcgtcggctacaagccaaccaaggcgcgggtgccgaccgacggcgcctttccgctctcg
cccacgctcgattcgatcgggccgatcgcgaccagtgtcgacgcctgtttccgcaccgat
gcgatcttggcgggagaggcgccccgccgccttgaccttgcgccgctcaaggggctgcgc
gccggcattccgcagggcttgccgctggccgatctggacgcgaccgtcgcggcgcgtttc
gccgatgcgctcgcgcgcttgggccaggcgggcatgacgctcagcgacgaagtcttcccg
caattcgacgcgatgcaggcgctccagtcgccggtgccgatcgcctcggtcgaggcctat
gccatccatcgcgatcgaatcgcgacccgcgcgcaggatttcgatccgatcgtgctggca
cggatgcaggcgggccgtgacgtgacgcccgaacgccaccggcagatgctggtggagcgc
gccgcgctggtgcgatcgatggacgcgcgcctgaccggactggacatattggtgctgccg
accacggcgatcgtcgccccgaccaaggccgaggtggcgaatgccgacgccttcgtcgcc
cgcaaccggctgctgctgcgcaacactggtctcggcaacagcttcgatctgtgcgccatt
tccctgccgctgccgcgcgagggcggcctgccggtcggcctgatgctgatggcgcgggcc
gggcaggaccagcgcctgttcgcgatcgcggcagcggtggaaaagctgctggcggtttag

DBGET integrated database retrieval system