KEGG   Sphingobium sp. YBL2: TZ53_00935Help
Entry
TZ53_00935        CDS       T03855                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
syb  Sphingobium sp. YBL2
Pathway
syb00471  D-Glutamine and D-glutamate metabolism
syb00550  Peptidoglycan biosynthesis
syb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    TZ53_00935
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TZ53_00935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syb01011]
    TZ53_00935
Enzymes [BR:syb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     TZ53_00935
Peptidoglycan biosynthesis and degradation proteins [BR:syb01011]
 Precursor biosynthesis
  Amino acid ligase
   TZ53_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AJR22565
UniProt: A0A0C5XE45
Position
complement(193437..194762)
Genome map
AA seq 441 aa AA seqDB search
MGIVSDVFAGRKYAVLGLARSGLATVECLAASGAEVVAWDSRDEARASVKGKAELADPTE
IDLKGFDGVVVSPGVPLNKHPIAMHAKLAGVPVIGDIELFALARPSLPRHRVVGITGTNG
KSTTTALVHHIVETAGIPTRMGGNIGLPIMGQDPLPEGGVYVLELSSYQIDLTGSLDCDV
AVLLNITPDHLDRYNGFEGYVASKARLFAMQSAGHAAVIATEDEPSRGIFHSVRHSRQGG
NDGVVEVRSSDIAPSAQAGWPALQGPHNAQNAAVAIAVARALGIGEATIEQGLQSYASLP
HRMQRVRELNGVLYVNDSKATNAASTAPALAAYPPVDGRKRLHWIVGGLAKTDNLDECAP
WFANVAQAYTIGEAGPMFAELLRPHMAVDDSEMLSAAVRRAARVAQPGDVVLLSPACASF
DQFRDFEARGDAFAAAVAALE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggggatcgtttccgacgtctttgcaggcaggaaatatgcggtgctggggttggcgcgg
tccggcctcgccacggtcgagtgcctggcggcgagcggggctgaggtcgtggcatgggac
agccgggacgaggcgcgcgcctccgttaagggcaaggcggagttggccgatcccaccgaa
atcgacctcaagggcttcgacggcgtggtggtgtcgcccggcgtgccgctcaacaagcac
cccatcgccatgcatgcgaagctcgcgggggtgccggtcattggcgacatagagctgttc
gcgctcgcccggcccagcctgcccaggcatcgggtggtggggatcaccggaaccaacggc
aagtccaccacgaccgctctggtccatcatatcgtcgagacggcgggcattcccacgcgg
atgggcggcaatatcgggctgccgatcatgggacaggacccgttgccggagggcggcgtc
tatgtgctggaactgtcgagctaccagatcgacctgacgggcagcctggattgcgacgtg
gcggtgctgctcaacatcacgccggatcatctcgaccgttataatggctttgaaggctat
gtagcctccaaggcgcggctgtttgcgatgcagtcggccgggcatgccgcggtaatcgcg
acggaagatgagccgagccgggggatattccattccgtccgtcattcccggcaaggcggg
aatgacggggttgtggaggtgcgatcgagcgacatcgctccctccgctcaggccggctgg
cccgcattgcaaggcccgcataacgcccagaacgccgccgtcgccatcgcggtcgcccgc
gcgctgggcatcggcgaagcgacaatcgaacagggcctgcaaagctatgccagccttccc
caccggatgcagcgggtgcgggaactgaacggcgtcctctacgtcaacgacagcaaggcg
accaacgccgcctcgaccgcgccggcgctggccgcctatccgccggtcgatggccgcaag
cggctgcactggatcgtcggcggcctggccaagaccgacaatctggacgagtgcgcgccc
tggttcgccaatgtggcccaggcctataccatcggcgaagcgggccccatgttcgctgag
ctgttgcgcccgcatatggcggtggacgattcggaaatgctatcggccgccgttcgccgc
gctgcgcgggtggcgcagccgggtgacgtggtgctgctgtcgccagcctgcgcgagtttc
gaccagttccgcgatttcgaggcgaggggcgatgccttcgccgctgccgtcgccgcgctg
gaataa

DBGET integrated database retrieval system