KEGG   Sphingobium sp. YBL2: TZ53_03310Help
Entry
TZ53_03310        CDS       T03855                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
syb  Sphingobium sp. YBL2
Pathway
syb00260  Glycine, serine and threonine metabolism
syb01100  Metabolic pathways
syb01110  Biosynthesis of secondary metabolites
syb01120  Microbial metabolism in diverse environments
syb01130  Biosynthesis of antibiotics
syb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TZ53_03310
Enzymes [BR:syb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     TZ53_03310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AJR22935
UniProt: A0A0C5XF40
Position
683014..684030
Genome map
AA seq 338 aa AA seqDB search
MHFFSDNATPVCPEVMAAIAAADHADHGYDGDGWSARLNGAFSDLFGTQAVALWIATGTA
ANSIALACLCPPYGGVLCHEEAHIVVDECGAPGFYTHGASLMALPGAGAKLSPDAVTARL
RAIRPDVHQVPARAISITQATEYGVVYSPDEVAALGDLAREHGLGFHMDGARFANAVAHL
GCHPGDVTWRAGVDILSFGCVKNGGMIGEALVFFGDRAEARAAEAARWRKRAGHLFSKGR
YLAAQALAMVEGDLWLRNARAANAAAQALAEGAAGRLMHPVEANELFVRLTEAERAQLRA
QGFDFYDWGADAARLVTNWSQDAASVQPLADALRALKG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcactttttttccgacaatgcgacgccggtctgtccggaggtgatggcggccatcgcg
gccgctgaccatgccgaccatggctatgacggcgatggctggagcgcccggctgaacggc
gccttttccgacctgttcgggacgcaggcggtggcgctgtggatcgcgacgggcacggcg
gcgaacagcatcgcgctggcctgcctctgcccgccctatggcggggtgctgtgccatgag
gaggcgcatatcgtcgtcgacgaatgcggcgcgcccggcttctacacccatggggcgagc
ctgatggcgctgcccggcgcgggcgcgaaactgtcgcccgatgccgtgaccgctcggctg
agggcgatccgccccgatgtgcatcaggtgccggcgcgggcgatcagcatcacccaggcg
accgaatatggggtggtctacagccccgatgaggtggcggcgctgggcgatctggcgcgg
gaacatgggctgggtttccacatggacggggcgcgcttcgccaatgcggtggcgcatctg
ggctgccatccgggcgatgtgacctggcgggcgggcgtcgacatactctctttcggctgc
gtcaaaaatggcgggatgatcggggaggctctggtctttttcggggaccgggcggaggcg
cgggcggccgaagcggcgcgttggcgcaagcgggcggggcatctcttctccaaggggcgc
tatctcgcggcgcaggcgctggcgatggtcgagggcgacctctggctgcgcaatgcgcgg
gcggccaatgcggcggcccaggcgctggcggagggcgcggcgggtcggctgatgcatccg
gtcgaggccaatgagctgttcgtgcggctcaccgaagcggaaagggcgcagttgcgggcg
cagggcttcgatttctacgattggggcgcggatgcggcgcggctcgtcaccaactggtcg
caggatgccgccagcgtgcagcctctggccgatgcgctgagggcgttgaagggatga

DBGET integrated database retrieval system