KEGG   Sphingobium sp. YBL2: TZ53_07765Help
Entry
TZ53_07765        CDS       T03855                                 

Gene name
putA
Definition
(GenBank) transcriptional regulator
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
syb  Sphingobium sp. YBL2
Pathway
syb00250  Alanine, aspartate and glutamate metabolism
syb00330  Arginine and proline metabolism
syb01100  Metabolic pathways
syb01110  Biosynthesis of secondary metabolites
syb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TZ53_07765 (putA)
   00330 Arginine and proline metabolism
    TZ53_07765 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:syb03000]
    TZ53_07765 (putA)
Enzymes [BR:syb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     TZ53_07765 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     TZ53_07765 (putA)
Transcription factors [BR:syb03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    TZ53_07765 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AJR26254
UniProt: A0A0C5XAA3
Position
complement(1676640..1680242)
Genome map
AA seq 1200 aa AA seqDB search
MTNPPPFIDFAPAIRPQSPLRQAITAAYRRDEAECLAPLLEAAALPDAMRQGVRDMARRL
VTTLRANGKGSGVEALVQEYSLSSQEGVALMCLAEALLRIPDDATRDALIRDKIADGDWG
GHLGGGKSLFVNAATWGLVVTGKLVGSVDDRGLGAALTRLMARLGEPVIRRGVDLAMRMM
GEQFVTGETIGEALKRARTEEAKGFQYSYDMLGEAAATAADAARYLEDYRQAIHAIGRAS
DGRGVYAGPGISIKLSALHPRYSRAQAERVMGELLPRVKELALLAKSYDIGLNIDAEEAD
RLELSLDLLESLALDPDLAGWNGLGFVVQAYGKRCPFVIDWIVDLAQRAGRRIMVRLVKG
AYWDAEIKRAQVDGMADFPVYTRKVHTDVAYIACAKKLLAARDRVFPQFATHNAQTLATV
HHLAGPGFTLGDYEFQCLHGMGEPLYEQVVGKGNLDRPCRIYAPVGTHETLLAYLVRRLL
ENGANSSFVHRIADPAVPVEEMIADPVEQVLAMPHPGARHAEIALPSGLYPDRRNSDGID
LSDENALAMLAQALAESAQINWTAAPQGEEGTARLVLNPANRRDVVGTVFEACADHARAA
VMRADESEWAQVPVAERAAMLERAADAMQARMPILLGLIVREAGKSLPNAIAEVREAIDF
LRYYAAQARAAFGAAQTALGPVVCISPWNFPLAIFTGQVAAALVAGNAVLAKPAEETPLI
AAEAVRLLYEAGVPGDALQLVPGAGEIGAALVAAPQTAGVLFTGSTEVARLIQRQLAARL
SASGRPIPLIAETGGQNAMIVDSSALAEQVVADVIASAFDSAGQRCSALRILCLQEDVAD
RTLAMLKGALRELQIGRTDRLAVDIGPVITDEAKEGIERHIEAMRALGCAVEQQPLPQET
AHGSFVPPTIIEIDDIAQLRREVFGPVLHVIRFPRTGLNALVDAINATGYGLTFGLHTRL
DDTVAQVTGRVKAGNLYVNRNVIGAIVGVQPFGGRGLSGTGPKAGGPLYLGRLVAVPPVF
AERAGSLRSPLSDFADWLAAKGEAEASAMARRCGDASALGVEMTLPGPVGERNLYALHPR
GLIGMRPATRQGLLQQMAAVLATGNRGVLRDMELPLGLPAPIAAHFTSQADGLLRAVLVE
GDAARIGAAVRDVAGMPGPVVSVHAAGADGGYPLDWLLEEVSTSINTTAAGGNASLMMIG
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacccgccccccttcatcgatttcgcccccgccatccggccgcagtcgccgctc
cgccaggccatcaccgccgcctatcgccgcgatgaagcagagtgcttggcgcccctgctg
gaagccgccgcgctgcccgacgccatgcggcagggggtgcgcgacatggcgcgcaggctg
gtgacgacgctgcgcgccaatggcaagggcagtggggtcgaggcgctggtgcaggaatat
tcgctctccagccaggagggcgtggcgctgatgtgcctggccgaagcgctgctgcgcatt
cccgacgatgcgacccgcgacgcgctgatccgcgacaagatcgctgacggcgactggggc
gggcatctgggtggcggcaagtcgctgttcgtcaatgcggcgacctgggggctggtggtg
acgggcaagctggtcggcagcgtggacgaccggggcttaggcgcggcgctgacccggctg
atggcgcggctgggcgagccggtgatccggcgcggcgtcgacctcgccatgcggatgatg
ggcgagcagttcgtgaccggcgagaccatcggggaagcgctgaagcgggcgcggacggaa
gaggcgaaaggcttccagtacagctatgacatgctgggggaggcggcggcgacggcggcg
gacgcggcccgctatctggaggattatcggcaggcgatccacgccatcggccgggcgtcg
gacgggcgcggcgtctatgccgggccgggcatctcgatcaagctgtcggcgctgcatccg
cgttatagccgcgcccaggcggagcgggtcatgggggaattgctgccccgggtgaaggag
ctggcgctgctcgcgaaaagctatgacatcggcctcaacatcgatgcggaggaggcggat
cggctggaattgtcgctcgacctgctggagagtctggccctcgatccggatttggcgggg
tggaatgggctgggcttcgtggtgcaggcctatggcaagcgctgtcccttcgtcattgac
tggatcgtcgatctggcccagcgcgccgggcggcggatcatggtgcggctggtcaagggc
gcctattgggacgcggagatcaagcgggcgcaggtcgatgggatggcggacttcccggtc
tatacgcggaaggtgcatacggacgtcgcctatatcgcctgcgcgaagaagttgctggcg
gcgcgggaccgggtgttcccgcaattcgcgacgcataatgcgcagacgctggcgacggtc
catcatctggcggggccgggtttcacgctgggcgactatgagtttcagtgcctgcacggc
atgggcgagccgctgtacgagcaggtggtggggaaggggaatctggaccgtccctgccgc
atctatgcgccggtcggcacgcatgagacgctgctcgcctatctggtgcggcggctgctg
gaaaatggcgcgaacagttccttcgtgcaccgtattgccgatccggcggtgccggtggag
gagatgatcgcggacccggtcgagcaggtgctggcgatgccgcatccgggcgcgcggcat
gcggagatcgcgctgccgtccggactgtatccggatcggcgcaattcggacgggatcgac
ctgagcgacgagaatgcgctggcgatgctggcgcaggcgctggccgaaagcgcgcaaatc
aattggacggcggcgccgcagggcgaggaaggcacggcgcggctggtgctgaaccccgcc
aatcggcgcgatgtcgtggggacggtgttcgaggcgtgtgcggaccatgcgcgggcggcg
gtcatgcgcgctgacgaaagcgaatgggcgcaggtgccggtggccgaacgcgccgcgatg
ctggagcgggccgccgacgcgatgcaggcgcgcatgcctatcctgttggggctgatcgtg
cgggaagcgggcaagtcgctgcccaacgccatagccgaagtgcgggaggcgatcgatttc
ctgcgctattatgcggcgcaggcgcgggcggccttcggcgcggcgcagaccgccttgggg
ccggtcgtgtgcatttcgccctggaatttcccgctggcgatcttcaccgggcaggtcgcg
gcggctttggtcgcgggcaatgcggtgctggccaagcctgccgaggagaccccgctgatc
gcggcggaggcggtgcggctgctgtatgaggctggggtgccgggcgatgcgttgcagctt
gtgcccggcgcgggcgagatcggcgcggcgctggtggcggcgccgcagaccgccggggtg
ctgttcactggatcgaccgaggtggcgcggctgatccagcggcaattggccgcccgcctc
tccgcttcgggcaggcccattccgctgatcgcggagacgggcgggcagaatgcgatgatc
gtcgacagctccgcgttggcggagcaggtggtggcggatgtcatcgcctccgccttcgac
agcgcggggcagcgctgttcggcgctgcgcatcctctgcctgcaggaggatgtggcggac
cggacgctggcgatgctgaagggggcgctcagggaattgcagatcgggcggaccgaccgg
ctggcggtcgacatcgggccggtcatcacggacgaggcgaaggaagggatagaacggcat
atagaggcgatgcgggcgctgggctgcgcggtggagcagcagccgctgccgcaggaaacc
gcgcatggcagcttcgtgccgccgacgatcatcgagatcgacgacatcgcgcaattgcgg
cgcgaggtgttcgggccggtgctgcacgtcatccgtttccctcgcaccgggttgaacgcg
ctggtcgatgcgatcaacgcgaccggctatggcctgaccttcggcctgcatacgcggctg
gacgataccgtcgcgcaggtgacggggcgggtgaaggcgggcaatctttatgtgaaccgc
aatgtgatcggcgccattgtgggcgtacagccctttggcgggcggggcctgtcgggcacc
gggccgaaggcgggcgggccgctttatctggggcggctggtggcggtgccgccagtcttt
gccgagcgggccggttcgctccggtcgccgctcagcgattttgccgactggctggcggcg
aagggcgaggcggaggcttcggccatggcgcggcgctgtggcgatgcgtcggcgctgggc
gttgagatgaccctgccggggccggtgggggagcgcaacctctatgcgctgcatccgcga
ggactgatcgggatgcggcccgcgacgcggcaggggttgttgcagcagatggcggcggtg
ctggcgacgggcaatcgcggggtgctgcgggacatggaactgccgctggggttgcccgcg
cctattgcggcgcatttcacatcgcaggcggatgggctgcttagggcggtgctggtggag
ggcgatgccgcgcggatcggtgcggcggttcgggacgtggccggcatgccggggccggtc
gtcagcgtccatgcggcgggggcggatgggggatatccgctggactggctgctggaggag
gtgtcgacctccatcaacacgaccgctgcggggggtaatgccagcctgatgatgattggg
tga

DBGET integrated database retrieval system