KEGG   Sphingobium sp. YBL2: TZ53_08345Help
Entry
TZ53_08345        CDS       T03855                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
syb  Sphingobium sp. YBL2
Pathway
syb00071  Fatty acid degradation
syb00072  Synthesis and degradation of ketone bodies
syb00280  Valine, leucine and isoleucine degradation
syb00310  Lysine degradation
syb00362  Benzoate degradation
syb00380  Tryptophan metabolism
syb00620  Pyruvate metabolism
syb00630  Glyoxylate and dicarboxylate metabolism
syb00640  Propanoate metabolism
syb00650  Butanoate metabolism
syb00900  Terpenoid backbone biosynthesis
syb01100  Metabolic pathways
syb01110  Biosynthesis of secondary metabolites
syb01120  Microbial metabolism in diverse environments
syb01130  Biosynthesis of antibiotics
syb01200  Carbon metabolism
syb01212  Fatty acid metabolism
syb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:syb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TZ53_08345
   00630 Glyoxylate and dicarboxylate metabolism
    TZ53_08345
   00640 Propanoate metabolism
    TZ53_08345
   00650 Butanoate metabolism
    TZ53_08345
  Lipid metabolism
   00071 Fatty acid degradation
    TZ53_08345
   00072 Synthesis and degradation of ketone bodies
    TZ53_08345
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TZ53_08345
   00310 Lysine degradation
    TZ53_08345
   00380 Tryptophan metabolism
    TZ53_08345
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TZ53_08345
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TZ53_08345
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TZ53_08345
Enzymes [BR:syb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TZ53_08345
Exosome [BR:syb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TZ53_08345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJR23727
UniProt: A0A0C5XMA1
Position
complement(1809620..1810801)
Genome map
AA seq 393 aa AA seqDB search
MTAEIILAHPVRTPIGSYNGTLKDVPAAELGAVAIRETVRRAGLSPDAVGAVTMGNVIQA
GNRMNPARQAAIHAGLPVSVPALTVNRVCGSGAQAIVTAAQEVQLGLHDVAIAGGMENMD
RAPYLMTGGRWGYRMGDAAIIDSMLHDGLNDAFSGQHSGWHTEDLVTRSQISRDAQDRWA
ERSQKRFVQAQSEGRFAAEIAPVTIKGRKGDVSFASDEAPRADTTLEGLARLKPAFRPDG
TITAGNAPGLNSGASAMLVATRAWAEANGVEPAGRIVSYAVAALEPGLFGLAPVPAVVKA
VERAGWKLPDVERFEINEAFAAVPLAIIKELGLPEDIVNVEGGAIAHGHAIGATGAVLTT
RLLHSMKRDGVRRGLVTLCIGGGQGIALALETL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcggaaatcatcctcgcccatcccgtccgcaccccgatcgggagctataacggc
acgctcaaggacgtgccggcggccgaactgggcgccgtcgccatccgggaaaccgtgcgc
cgcgcagggctgtcgccggatgccgtcggcgcggtcaccatgggcaatgtgatccaggcc
ggcaacaggatgaacccggcgcgccaggcggcgatccacgccgggctgccggtctcggtc
cccgccctcaccgtcaaccgggtctgcggatcgggcgcgcaggcgatcgtgaccgccgcg
caggaagtgcagcttggcctgcacgacgtcgccatcgccggcggcatggagaatatggac
cgcgcgccttatctgatgaccggcggccgctggggttatcgcatgggcgacgccgcgatc
atcgattccatgctgcatgacggcctgaacgacgccttttccggccagcattccggctgg
catacggaggatctcgtcacccgctcccagatttcgcgggatgcgcaggaccgctgggcc
gaacgctcgcagaagcgcttcgtgcaggcgcagtcggaaggccggttcgcggcggagatc
gcccccgtcaccatcaagggccgcaagggcgacgtcagcttcgccagcgacgaggcgccc
cgcgccgatacgacgctggagggactggcccggctgaagcccgccttccgcccggacggc
acgatcaccgccggcaatgcccccggcctcaacagcggcgcatccgcgatgctggtcgcc
acccgcgcctgggccgaggcgaacggcgtcgaaccggcgggccggatcgtctcctacgcc
gtcgccgcgctggagccgggcctcttcggcctcgcgccggtccctgccgtggtgaaggcg
gtcgaacgcgccggctggaagctgccggacgtggagcggttcgagatcaacgaagccttc
gccgccgtacccctggccatcatcaaggaactcggcctgccggaggacatcgtcaatgtg
gagggcggcgcgatcgcccatggccatgccatcggcgcgaccggcgcggtgctgacgacc
cggctgctgcattcgatgaagcgggacggcgtgcggcggggccttgtcacgctttgcatc
ggcggcggccagggtatagcgctcgcactggaaacgctgtga

DBGET integrated database retrieval system