KEGG   Sphingobium sp. YBL2: TZ53_14220Help
Entry
TZ53_14220        CDS       T03855                                 

Definition
(GenBank) malonic semialdehyde reductase
  KO
K05886  serine 3-dehydrogenase (NADP+) [EC:1.1.1.276]
Organism
syb  Sphingobium sp. YBL2
Brite
KEGG Orthology (KO) [BR:syb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TZ53_14220
Enzymes [BR:syb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.276  serine 3-dehydrogenase (NADP+)
     TZ53_14220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 Epimerase ADH_zinc_N F420_oxidored GDP_Man_Dehyd Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AJR24708
UniProt: A0A0C5XUP8
Position
complement(3084543..3085292)
Genome map
AA seq 249 aa AA seqDB search
MAGTALITGATAGIGAASARRFVAAGWKAIVTGRRAERLDALVEELGADRVHAISFDMRD
EAAIDAALAALPPGFADVDLLINNAGLALGTAPAQQADLDQWRQMIDTNVTSLVTITHKL
LPRLIERRGAIINISSVAATYPYAGGNVYGGTKAFVSQFSLGLRSDLHGTGVRVTSIEPG
MVETEFTLVRTGSQAASDALYGSANPMTAEDIAETLFWVASQPPHLNLNRIELMPVTQSF
AGFQVAREG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcagggacggcgctgatcaccggagcaaccgcgggcataggcgccgcatcggcgcgg
cgtttcgtcgccgccgggtggaaggcgatagtcaccgggcgccgcgccgaacggctggac
gcgctggttgaggaactgggcgcggacagggtgcatgcgatcagcttcgacatgcgcgac
gaagccgccatcgacgcggccttggccgcgctgcctccgggctttgccgatgtcgacctg
ctgatcaacaatgcgggactggcattgggcacggcgccggcgcagcaggccgatctcgac
cagtggcgccagatgatcgacaccaatgtcaccagcctcgtcaccatcacccataagctg
ctgccccgcctgatcgagcgcaggggggcgatcatcaacatcagttcggtcgcggcgacc
tatccctatgcgggcggcaacgtctatggcgggaccaaggcgttcgtcagccagttctcg
ctggggctgcggtcggacctgcatggcacgggggtccgcgtgacgtccatcgaaccgggc
atggtcgaaaccgaattcaccctggtccgcactggcagccaggcggcatcggacgcgctc
tatggctccgccaatccgatgacggcggaagatattgcggaaaccctgttctgggtcgcc
agccaaccgccccatctgaacctcaaccgcatcgaactgatgccggtcacccagtccttc
gccggcttccaggtcgctcgcgagggctag

DBGET integrated database retrieval system