KEGG   Sphingobium sp. YBL2: TZ53_18990Help
Entry
TZ53_18990        CDS       T03855                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
syb  Sphingobium sp. YBL2
Pathway
syb00071  Fatty acid degradation
syb00072  Synthesis and degradation of ketone bodies
syb00280  Valine, leucine and isoleucine degradation
syb00310  Lysine degradation
syb00362  Benzoate degradation
syb00380  Tryptophan metabolism
syb00620  Pyruvate metabolism
syb00630  Glyoxylate and dicarboxylate metabolism
syb00640  Propanoate metabolism
syb00650  Butanoate metabolism
syb00900  Terpenoid backbone biosynthesis
syb01100  Metabolic pathways
syb01110  Biosynthesis of secondary metabolites
syb01120  Microbial metabolism in diverse environments
syb01130  Biosynthesis of antibiotics
syb01200  Carbon metabolism
syb01212  Fatty acid metabolism
syb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:syb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TZ53_18990
   00630 Glyoxylate and dicarboxylate metabolism
    TZ53_18990
   00640 Propanoate metabolism
    TZ53_18990
   00650 Butanoate metabolism
    TZ53_18990
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TZ53_18990
   00072 Synthesis and degradation of ketone bodies
    TZ53_18990
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TZ53_18990
   00310 Lysine degradation
    TZ53_18990
   00380 Tryptophan metabolism
    TZ53_18990
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TZ53_18990
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TZ53_18990
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TZ53_18990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syb04147]
    TZ53_18990
Enzymes [BR:syb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TZ53_18990
Exosome [BR:syb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TZ53_18990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C 3HCDH ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJR26503
UniProt: A0A0C5XZ81
Position
4121330..4122502
Genome map
AA seq 390 aa AA seqDB search
MSDIVITAAKRTAVGSFMGAFGSTPAHELGRTAIVAALAQAGVAPEEVDEVILGQVLTAA
QGQNPARQAAVNAGIPVERTAIGLNQLCGSGLRAVALAAQAIRAGDARIMVAGGQESMSM
APHAQYLRGGAKMGPISFIDTMTHDGLTDAFNNYHMGITAENLAEKYQISREAQDEFAVG
SQNKAEAARASGRFKDEIVPVTIKGRKGDTVVDADEYIRAGATLEAMQGLRPAFKKDGTV
TAANASGINDGAAALVLMSADEAARRNATVLARIAGFATCGVDPSIMGIGPAPASRQALA
KAGWSLADLDLIEANEAFAAQALAVGQELGWDPEKVNVNGGAIAIGHPIGASGARVLTTL
LYEMQKRDARKGLATLCIGGGMGVAMCVER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagacatcgtcatcaccgctgccaagcgtaccgccgtcggcagcttcatgggcgcc
ttcgggtcgacccccgcgcatgagctgggccgcaccgccatcgtcgccgctctcgcccag
gccggcgtcgcgccggaggaagtggacgaagtcatattgggtcaggtcctgaccgcggcg
cagggccagaaccccgcccgtcaggccgccgtcaacgccggcattccggtggagcgcacc
gccatcggcctcaaccagctttgcggctctggcctgcgcgcggtcgctctggcggctcag
gcgatccgcgcgggcgacgcccgcatcatggtcgcgggcggtcaggaaagcatgtcgatg
gcgccccatgcgcaatatctgcgcggcggcgcgaagatggggccgatttccttcatcgac
acgatgacgcatgacggcctgaccgacgccttcaacaattatcacatgggcatcacggcg
gaaaatctggccgagaagtaccagatcagccgagaggcgcaggatgaattcgccgtcggc
agccagaacaaggccgaagccgcccgcgcatcgggccgcttcaaggatgagatcgttccc
gtgacgatcaagggccgcaagggcgacaccgtcgtcgacgccgacgaatatatccgcgcc
ggcgccacgctggaggcgatgcagggcctgcgtccggccttcaagaaggacggcaccgtc
accgccgccaatgctagcggcatcaacgacggcgccgccgccctcgtgctgatgagcgcc
gatgaggccgccaggcgcaacgcgaccgtgctggcgcgcatcgccggcttcgccacctgc
ggcgtcgatccctcgatcatgggcatcggcccggctccggcgagccgtcaggcgctggcc
aaggcgggctggtcgctggccgatctggacctgatcgaagccaatgaagccttcgccgcg
caggcgctggcggtcggtcaggaactgggctgggacccggagaaggtcaatgtgaacggc
ggcgcgatcgccatcggccatccgatcggcgcttcgggcgcccgcgtcctcaccaccctg
ctctacgagatgcagaagcgcgacgccaggaagggcctcgcgaccctctgcatcggcggc
ggcatgggcgtcgccatgtgcgtcgagcgctaa

DBGET integrated database retrieval system