KEGG   Sphingobium sp. YBL2: TZ53_23990Help
Entry
TZ53_23990        CDS       T03855                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
syb  Sphingobium sp. YBL2
Pathway
syb00010  Glycolysis / Gluconeogenesis
syb00020  Citrate cycle (TCA cycle)
syb00620  Pyruvate metabolism
syb01100  Metabolic pathways
syb01110  Biosynthesis of secondary metabolites
syb01120  Microbial metabolism in diverse environments
syb01130  Biosynthesis of antibiotics
syb01200  Carbon metabolism
Module
syb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:syb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TZ53_23990
   00020 Citrate cycle (TCA cycle)
    TZ53_23990
   00620 Pyruvate metabolism
    TZ53_23990
Enzymes [BR:syb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     TZ53_23990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_24 AAA_25 AAA_33
Motif
Other DBs
NCBI-ProteinID: AJR27043
UniProt: A0A0C5Y0R4
Position
3pYBL2-3:82819..84402
Genome map
AA seq 527 aa AA seqDB search
MLANLNDDPKVQRNLGTAQLIEEAVRNGEGLIAKDGPFVVATGKHTGRSAKDKFIVRDAE
TESSVWWGKTNVARTPEHFANLRADFVKALEGRTRLYVADLFGGSQPEHRVQVSVITELA
WHSLFVRTLLVRPTAAELDAFLPEYTIIDLPSFRADPARHGTRSETVVAVNLTEKLILIG
GTAYAGEMKKSVFGILNYLLPAKGVMPMHCSANIGPKGDTAVFFGLSGTGKTTLSADASR
TLIGDDEHGWSDTAVFNFEGGCYAKMIRLSAEAEPEIFATTRRFGTVLENVVIDPATREI
DLDDASLAENSRGSYPIDFIPNASRDNLGPVPKNIIFLTADAYGVLPPIARLTPDQAMYH
FLSGYTARVAGTEIGVTEPEATFSTCFGAPFMPRHPSVYGNLLKERIAKGGVKCWLVNTG
WSGGKATMEGISRMPIKATRALLNAALDGSLNNAEFREDPNFGFEVPIAVPGVDDKLLDP
RGAWADPAEYDRTARELVAKFIDNFAQFEDHVDASVRSAAPTARVDA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
ctgctggccaatctcaacgatgatccaaaagtccagcgcaatctcggaacggcgcaactc
atcgaggaagcagtccggaacggcgagggattgattgccaaggacggcccgttcgtggtt
gcgacgggcaagcacaccggccgttcggcgaaggacaagttcattgttcgggacgcggaa
accgaaagcagcgtctggtggggcaaaaccaatgtagcgaggacgcctgagcacttcgcc
aatctgcgcgccgattttgtgaaggcgctggagggcaggaccaggctttacgtcgcggat
ctcttcggcggctcgcagcccgagcaccgcgttcaggtgagcgtcatcacggagctcgcc
tggcacagtctcttcgtgcgcaccctgcttgtgcgccctaccgccgcagagctcgacgca
ttcctccccgagtacaccatcatcgaccttcccagtttccgggccgatcccgcgcgccac
ggcacgcgcagcgagacggtggtcgccgtcaacctgaccgagaagctgatcctcatcggc
gggaccgcctatgcgggcgagatgaagaaatcggtctttggcatcctcaactacctgctc
ccggccaagggcgtgatgccgatgcattgctcggccaatatcggtccgaagggcgacacc
gccgtcttcttcggcctgtcgggcacgggcaagacgacgctctcggctgacgccagccgc
acgctgatcggagacgacgagcatggttggtcggataccgccgtgttcaatttcgaaggt
ggctgctacgccaagatgatccgtctgtcggcggaggcggagccggagatcttcgcgacg
acacgccgttttggcacggtgctcgaaaatgtggtgattgatcctgccacgcgcgagatt
gacctcgacgacgcctcactcgcggagaacagccgcggctcttaccccatcgacttcatt
cccaatgcctcgcgggacaatctcggtccggtgccgaagaacatcatctttctcaccgcc
gatgcctatggcgtgctgccgccaatcgcccgcctgactccggaccaggcgatgtatcac
ttcctgtcaggctataccgcgcgcgttgccggcactgagatcggcgtgaccgagccggag
gcgaccttctcgacctgctttggcgcaccgttcatgccccgccatccttctgtctacggc
aatctgctcaaggaacggatcgccaagggcggggtcaagtgctggttggtcaacaccggc
tggtcgggcggcaaggcgaccatggaaggcatcagccggatgccgatcaaggccacgcgc
gcgctgctcaatgccgcgctggatggcagcctcaataatgctgaattccgtgaggacccc
aattttggcttcgaggtgccgatcgcggtgcccggcgtcgatgacaagctgctcgatccg
cgtggtgcgtgggctgatcctgccgaatatgacagaaccgcaagagagctggtggccaag
ttcatcgataatttcgcgcaatttgaagatcatgtcgacgcaagcgtgcggtcggccgcc
cccacggccagggtcgatgcctga

DBGET integrated database retrieval system