KEGG   Synechococcus elongatus PCC6301: syc0089_d
Entry
syc0089_d         CDS       T00163                                 

Gene name
petJ
Definition
(GenBank) cytochrome c553
  KO
K08906  cytochrome c6
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0089_d (petJ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0089_d (petJ)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosynthetic electron transport
   syc0089_d (petJ)
SSDB
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C550 Cytochrom_C
Other DBs
NCBI-ProteinID: BAD78279
CyanoBase: syc0089_d
CYORF: syc0089_d
UniProt: P07497
Position
99903..100238
AA seq 111 aa
MKRILGTAIAALVVLLAFIAPAQAADLAHGGQVFSANCAACHLGGRNVVNPAKTLQKADL
DQYGMASIEAITTQVTNGKGAMPAFGSKLSADDIADVASYVLDQSEKGWQG
NT seq 336 nt   +upstreamnt  +downstreamnt
atgaaacgaattttgggtacggcgatcgcggcgctggttgtgctgttggccttcatcgct
cctgctcaagcagcggatcttgcccatggtggccaagtcttttctgcaaactgtgctgcc
tgccacctgggcggacgcaatgttgtcaaccccgccaagaccttgcagaaggcagatctt
gaccagtacggcatggcctcgattgaagccatcaccacccaagtcacgaatggtaagggg
gcaatgcctgcttttggcagcaagctaagcgctgacgacatcgctgacgtggcaagctac
gtccttgaccagtctgagaaaggctggcagggctaa

DBGET integrated database retrieval system