KEGG   Synechococcus elongatus PCC6301: syc0124_d
Entry
syc0124_d         CDS       T00163                                 

Gene name
ribA
Definition
(GenBank) riboflavin biosynthesis protein RibA
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00740  Riboflavin metabolism
syc00790  Folate biosynthesis
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    syc0124_d (ribA)
   00790 Folate biosynthesis
    syc0124_d (ribA)
Enzymes [BR:syc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     syc0124_d (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     syc0124_d (ribA)
SSDB
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Other DBs
NCBI-ProteinID: BAD78314
CyanoBase: syc0124_d
CYORF: syc0124_d
UniProt: A0A0H3K2E6
Position
134088..135773
AA seq 561 aa
MTLPEDFQFDAIADAIAEIKAGRSVVVVDDENRENEGDLICAAQFATPEKINFMAVEARG
LICLAMTGDRLDQLDLPLMVDRNTDSNQTAFTVSIDAAPHLGVSTGISAEDRARTIQATI
NPLTKPHDLRRPGHIFPLRSREGGVLKRAGHTEAAVDLARMAGLYPAGVICEIQNPNGSM
ARLPDLIDYARQHRLKLISIADLISYRLQHERFVIRETIATLPSEFGQFTIFAYRNSLDG
SEHVALVKGDPSRFSQQPVMVRVHSECLTGDAFGSLRCDCRMQLQAAMKMIENAGQGVIV
YLRQEGRGIGLINKLKAYSLQDLGLDTVEANARLGFPADLRNYGVGAQILNDLGVTRIRL
ITNNPRKIAGLKGYGLEVVDRVPLLIEATPYNSSYLATKGEKLGHLLLKTHLAAIALHLT
PELQNNPYRQTLIGQIRSLVQGEGLFLQEELRSVASALFGPQVLTLQVGLAQSEAIAADW
YRSPDSPLADQLQHCLEQMAAIDGLEDLEFLLADGHDPLTSLQVQLDRQSLPLPDLSRQF
KTLKLQQIYHLQLQERPSFVS
NT seq 1686 nt   +upstreamnt  +downstreamnt
gtgactttgccagaagactttcagtttgatgcgatcgccgacgcgatcgcggaaatcaaa
gccggtcgctcggtggtggtggttgacgatgaaaaccgcgaaaacgaaggtgacctgatc
tgtgcggctcagtttgccacccccgaaaagatcaacttcatggcggtggaagccagaggc
ttaatctgtctggctatgacgggcgatcgcctcgatcaactcgatttgccgctgatggtc
gatcgcaacaccgacagcaatcaaactgcctttaccgtcagcattgatgcggccccccat
ctcggcgtcagcactggtatttctgctgaggatcgggcgcgaacgattcaagccacgatc
aatcccctgaccaagccccacgatctgcgccgccccggtcacatttttccgctgcgatcg
cgggagggcggtgtcctcaagcgggctggacataccgaagccgctgtcgatctagcacgg
atggctgggctctatcccgctggggtgatctgtgagatccagaatcccaatggatcgatg
gcgcggctgccggatttgattgactacgctcgtcagcatcggctgaaactgatcagcatt
gctgatctgatcagctatcggctgcaacatgagcgcttcgtgattcgcgaaacgatcgcg
actttgccgagtgagttcgggcagttcacgatttttgcctaccgcaacagcttggatggc
tcagagcatgtggcgctggtcaagggcgatcccagccgctttagtcagcagccagtcatg
gtgcgcgttcactccgaatgtctgaccggtgatgccttcggttcactgcgctgcgattgc
cggatgcagctgcaggccgcgatgaagatgattgaaaatgctggtcagggcgtgattgtc
tacctacggcaagaaggtcgtggcattggcctaatcaacaaactcaaggcttattcacta
caagatttggggctagataccgtcgaagccaacgcccgccttggctttccggctgacctg
cgcaattacggcgtgggggcgcaaatcctcaacgacctaggggtaacgcgcattcgtctg
atcaccaacaatccccgcaaaattgccggcctcaagggctatggactagaagtggtcgat
cgcgtccccctgctgattgaagccaccccctacaattcgtcttatctggcgactaagggt
gaaaaactcggccacttgctcctcaaaacccatctagccgcgatcgctctgcatctcacg
ccggaattacagaacaatccctatcgccaaacgctgattggtcagattcgcagtctggtg
caaggagagggattattcctgcaagaagagctgcgatcggtggcgtcagcgctctttggc
ccccaggtcctaaccctgcaggtcggcttggcccagtcagaagcgatcgcagcggactgg
taccgctcgcccgattccccactggccgaccagctgcagcattgcttggaacaaatggct
gcgatcgatggcttagaagatctggaatttctgctggcggatggtcatgacccgctaact
agcttgcaggtgcagctcgatcgccagtcgttaccgctaccggatctgagccgccagttc
aaaaccctgaagctgcagcagatctatcacttacagctgcaggaacgaccgagctttgtc
agctga

DBGET integrated database retrieval system