KEGG   Synechococcus elongatus PCC6301: syc0203_cHelp
Entry
syc0203_c         CDS       T00163                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00010  Glycolysis / Gluconeogenesis
syc00620  Pyruvate metabolism
syc00640  Propanoate metabolism
syc00680  Methane metabolism
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01120  Microbial metabolism in diverse environments
syc01130  Biosynthesis of antibiotics
syc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    syc0203_c
   00620 Pyruvate metabolism
    syc0203_c
   00640 Propanoate metabolism
    syc0203_c
  Energy metabolism
   00680 Methane metabolism
    syc0203_c
Enzymes [BR:syc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     syc0203_c
Lipid biosynthesis proteins [BR:syc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   syc0203_c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAD78393
CyanoBase: syc0203_c
CYORF: syc0203_c
UniProt: A0A0H3K2M6
Position
complement(235638..237608)
Genome map
AA seq 656 aa AA seqDB search
MSQPTIESILQEKRVFPPSAEFASAARINPEAYEALCQKAAADPVAFWGELAAQELDWFE
PWQQTLDWSNPPFAKWFVGGKLNISHNCLDRHLTTWRKNKAAIIWEGEPGDSRTLTYAQL
HREVCQFANVLKSLGIQKGDVVGVYMPMIPEAAIAMLACARIGAVHSVVFGGFSAEALRD
RLVDGQAKLVVTADGGWRKDAIVPLKDSVDQALEGNACPSVQHVLVVERTKQDIHMEPGR
DHWWHELQQTVSATCPAEPMDSEDLLFVLYTSGSTGKPKGVVHTTGGYNLYAHITTQWTF
DLQDTDVYWCTADVGWITGHSYIVYGPLSNGATTLMYEGAPRASNPGCFWDVIEKYGVTT
FYTAPTAIRAFIKMGEQHPAARDLSSLRLLGTVGEPINPEAWIWYHRVIGGDRCPIVDTW
WQTETGGHMITSLPGAVPTKPGSATKPFPGILADVVDLDGRSVPDNEGGYLVIRHPWPGM
MRTVYGDPDRFRRTYWEHIPPQNGQYLYFAGDGARRDADGYFWVMGRVDDVINVSGHRLG
TMEIESALVSHPAVAEAAVVGRPDDLKGEGIVAFITLESGIETGDELVKDLKKHVAQEIG
AIARPDEIRFSEALPKTRSGKIMRRLLRSLAAGQEVSGDTSTLEDRSVLDKLRQGT
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccaacgatcgagtcgatcctccaagagaagcgggtttttcctccctcggca
gaatttgccagtgcggcgcgaatcaatcccgaagcgtacgaagcgctctgccagaaagcg
gcggccgatccggtggctttttggggcgaattggcagctcaggagctggactggtttgag
ccttggcaacagacgctggactggagcaatccgccgtttgcgaagtggtttgtcggtggc
aaactcaatatttcccacaactgcctcgatcgccacttgacgacttggcgcaaaaataaa
gcggcgattatctgggaaggcgaacccggtgactcacggacgctgacctacgcgcaactg
catcgcgaggtctgtcagttcgccaacgtgctcaaatccttgggcattcaaaaaggtgat
gtcgttggcgtttacatgccgatgattcccgaagcggcgatcgccatgctggcctgtgcg
cggattggcgcagtgcatagcgttgtctttgggggctttagtgcggaagcactgcgcgat
cgcttggtggatggccaagccaagctggttgtcacggcggatggtggctggcgcaaagat
gcgatcgtgcccctcaaggattctgttgatcaagccctggaaggcaatgcctgccccagc
gtccagcatgtcctcgtggtggaacggacgaagcaagacatccacatggaaccggggcgc
gaccattggtggcatgagctgcaacagaccgtcagcgctacctgtccggcggagccgatg
gacagcgaagatctgctcttcgtgctctacacctccggtagcaccggcaaacccaagggt
gtcgtccacaccaccggcggttacaacctctacgcccacatcaccacccagtggactttt
gacctgcaggataccgatgtctactggtgtacggcggacgtcggctggattaccggtcac
agctacatcgtctacgggccgctctccaacggtgcgaccacactgatgtatgagggtgcc
ccccgcgcttctaatcccggttgcttctgggatgtgattgaaaagtatggcgttacgacc
ttctacacagccccaacagcgatccgcgccttcatcaaaatgggtgagcagcatcccgcc
gctcgcgacctctcctcattgcgactgttgggcaccgtcggagagcccatcaatcccgaa
gcttggatctggtatcaccgcgtcattggtggcgatcgctgcccgattgtcgatacctgg
tggcagaccgaaacgggcggccatatgattacgtcgctgccgggagccgtgccgaccaaa
ccgggctctgccactaaacctttcccgggcatcttggcagacgttgtcgatctggatggg
cgatcggtgccggataacgaaggtggctacttggtgattcgccatccttggccaggcatg
atgcgcacggtctacggcgatcccgatcgcttccgtcgcacctattgggagcatattcct
ccgcaaaatggccagtatctctacttcgccggcgatggcgcgcgccgcgatgccgatggc
tatttctgggtgatggggcgcgtcgatgacgtgatcaatgtctcaggtcaccgtctcggc
acgatggaaattgagtcggccttggtctcccatccggcagttgccgaagctgcagttgtc
ggtcggcctgacgatctcaaaggtgaaggcattgttgctttcatcacgctggaatcgggc
attgagactggcgatgagttagttaaagacctgaagaaacacgtcgcccaagaaattggc
gcgatcgctcgtcccgatgaaattcgcttcagtgaggcgctgcccaaaacgcgatcgggc
aagattatgcgccgtctgttgcgcagtctcgccgctggtcaagaagtttcgggcgacact
tccaccttggaagatcgctcggtgctcgataagctgcgtcaaggcacttag

DBGET integrated database retrieval system