KEGG   Synechococcus elongatus PCC6301: syc0300_d
Entry
syc0300_d         CDS       T00163                                 

Gene name
psaF
Definition
(GenBank) photosystem I reaction center subunit III precursor
  KO
K02694  photosystem I subunit III
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00163  Photosystem I
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0300_d (psaF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0300_d (psaF)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Main subunits
    syc0300_d (psaF)
SSDB
Motif
Pfam: PSI_PsaF
Other DBs
NCBI-ProteinID: BAD78490
CyanoBase: syc0300_d
CYORF: syc0300_d
UniProt: P31083
Position
346544..347023
AA seq 159 aa
MRRLFAVVLAACLWLGFAPQASADVAGLTPCSESPRFIQRAEAAATPQAKARFENYSQAL
CGADGLPHLIVDGRLDHAGDFIIPSLLFLYIAGWIGWVGRSYLQAIKSDKDAAGKEIVID
VPLAVKFSLTGFAWPLAAFQEFSSGKLLAKADEITVSPR
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcgtcgactgtttgctgtcgtgctcgccgcctgtctgtggctgggctttgctccccag
gcttcggctgatgttgccggcctaacgccctgtagcgagtccccccgtttcatccaacgg
gctgaagccgctgcaactccccaggcgaaagcccgcttcgaaaactactcccaagccctt
tgcggcgcggatggtctgccccacctgatcgtggatggccgcctcgatcacgcgggtgat
ttcatcatccccagcttgctgttcctctacatcgccggctggattggctgggtgggtcgt
tcctacctgcaagccatcaagtctgacaaagatgctgcaggcaaagaaatcgtgatcgat
gtgcccttggccgtcaagttttccttgactggttttgcttggcccttggcagcgttccaa
gagttcagcagcggtaagctacttgcgaaagcagacgaaatcaccgtctcgccccgctaa

DBGET integrated database retrieval system