KEGG   Synechococcus elongatus PCC6301: syc0301_d
Entry
syc0301_d         CDS       T00163                                 

Gene name
psaJ
Definition
(GenBank) Photosystem I reaction center subunit IX
  KO
K02697  photosystem I subunit IX
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0301_d (psaJ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0301_d (psaJ)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Other common subunits
    syc0301_d (psaJ)
SSDB
Motif
Pfam: PSI_PsaJ
Other DBs
NCBI-ProteinID: BAD78491
CyanoBase: syc0301_d
CYORF: syc0301_d
UniProt: Q5N5C7
Position
347049..347183
AA seq 44 aa
MLAMDGLKRYLSSAPILATIWFAITAGILIEFNRFFPDLLFHPL
NT seq 135 nt   +upstreamnt  +downstreamnt
atgctagccatggatggtctcaaacgttatctatcttctgccccaattctcgcaacgatt
tggtttgcgattactgctggcatcctgattgaattcaatcgcttcttccctgatttgctc
ttccatcccctctag

DBGET integrated database retrieval system