KEGG   Synechococcus elongatus PCC6301: syc0319_d
Entry
syc0319_d         CDS       T00163                                 

Gene name
petA
Definition
(GenBank) apocytochrome f component of cytochrome b6-f complex
  KO
K02634  apocytochrome f
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00162  Cytochrome b6f complex
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0319_d (petA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0319_d (petA)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Cytochrome b6/f complex [OT]
   syc0319_d (petA)
SSDB
Motif
Pfam: Apocytochr_F_N Apocytochr_F_C
Other DBs
NCBI-ProteinID: BAD78509
CyanoBase: syc0319_d
CYORF: syc0319_d
UniProt: Q5N5A9
Position
367901..368875
AA seq 324 aa
MNMRFSPKALVRQLGRLSLVACLSLGLLGAADWLQPQAAAAYPFWAQENYASPREATGKI
VCANCHLAKKPTEVEVPHSVLPDTVFKAVVKIPYDRSSQQVLGDGSKGGLNVGAVLMLPD
GFKLAPEDRISEELKEEIGNVYFTNYSADQENIILVGPLPGDDHQEIVFPVLSPDPAKDK
NVFFGKYQIHVGGNRGRGQVYPTGQKSNNGVYTASAAGVIDAVTETASGYDIVIRKADGS
TVTDAVPAGPSPIVAVGSEVAAGAALTNDPNVGGFGQIDTEIVLQSSNRVLGVIAFFFAV
MLAQIMLVLKKKQVEKVQAAELNF
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaacatgcgtttttctccaaaagctcttgtgcgccaactgggtcgcctgagcttggtt
gcctgcctcagcctgggactgttgggtgctgcagactggctccagcctcaagcagcggca
gcctatcccttctgggcccaagaaaactacgcttcgccgcgggaagcgaccggcaaaatt
gtctgtgcgaactgccacttggctaaaaagccaaccgaggtggaagtgcctcactccgtt
ctgcccgacaccgttttcaaagcggttgtcaaaatcccctacgatcgctcctcgcagcag
gtcttgggtgatggcagcaagggtggcctgaacgtcggtgctgttttgatgctgcccgac
ggtttcaaactggcgcctgaagaccgcatctccgaagaactgaaagaagagatcggcaac
gtctacttcaccaactactcggcagaccaagaaaacatcatcttggtgggcccgctgcct
ggcgatgaccatcaagagattgtcttcccggtactttcgcccgatccagccaaagacaaa
aacgtcttctttggtaagtatcaaattcacgtcggcggcaaccgtggccgtggtcaggtc
taccctaccggtcaaaagagcaataacggcgtttacaccgcttctgcagctggtgtgatc
gatgcggtcaccgaaacggctagcggctacgacatcgtcatccgtaaggcagatggttcg
accgtgaccgacgcagtgccggctggccccagcccgatcgtggcagtgggttcggaagtt
gcagctggcgcagcgctgaccaacgatccgaacgtcggtggctttggccaaatcgatacc
gagatcgtgctgcaaagcagcaatcgggtcttgggtgtgattgctttcttctttgctgtg
atgctggcgcagatcatgctggtgctcaagaagaaacaagtcgagaaagtgcaagctgct
gagctgaacttctag

DBGET integrated database retrieval system