KEGG   Synechococcus elongatus PCC6301: syc0373_d
Entry
syc0373_d         CDS       T00163                                 

Gene name
psbE
Definition
(GenBank) photosystem II PsbE protein
  KO
K02707  photosystem II cytochrome b559 subunit alpha
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00161  Photosystem II
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0373_d (psbE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0373_d (psbE)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    syc0373_d (psbE)
SSDB
Motif
Pfam: Cytochrom_B559a Cytochrom_B559
Other DBs
NCBI-ProteinID: BAD78563
CyanoBase: syc0373_d
CYORF: syc0373_d
UniProt: Q5N556
Position
410840..411091
AA seq 83 aa
MAGGSTGERPFTDIITSIRYWVIHSITIPALFIAGWLFVSTGLAYDAFGTPRPNEYFTQD
RTEVPIVSDRYSAKQQVDRFSAK
NT seq 252 nt   +upstreamnt  +downstreamnt
atggcaggcggatctaccggcgagcgtccgtttaccgacatcattaccagcatccgctac
tgggtgattcacagcatcacgattccagcgctattcatcgctggttggctgtttgtcagc
actggccttgcctatgatgccttcggtacgccgcgcccgaacgagtatttcacccaagat
cggacggaagtaccgatcgtgtctgatcgctatagtgcgaaacagcaagtggaccgtttc
tcggctaagtag

DBGET integrated database retrieval system