KEGG   Synechococcus elongatus PCC6301: syc0374_d
Entry
syc0374_d         CDS       T00163                                 

Gene name
psbF
Definition
(GenBank) photosystem II PsbF protein
  KO
K02708  photosystem II cytochrome b559 subunit beta
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00161  Photosystem II
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0374_d (psbF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0374_d (psbF)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    syc0374_d (psbF)
SSDB
Motif
Pfam: Cytochrom_B559
Other DBs
NCBI-ProteinID: BAD78564
CyanoBase: syc0374_d
CYORF: syc0374_d
UniProt: Q5N555
Position
411113..411247
AA seq 44 aa
MTSNNSNQPITYPIFTVRWLSVHALGVPSVFFLGAIAAMQFIQR
NT seq 135 nt   +upstreamnt  +downstreamnt
atgaccagcaacaactccaaccagccaatcacctatccgatcttcacggtgcgttggctg
tctgtgcacgctctgggcgtccccagcgtgttcttcctgggcgcaattgcggccatgcaa
ttcattcaacgctaa

DBGET integrated database retrieval system