KEGG   Synechococcus elongatus PCC6301: syc0375_d
Entry
syc0375_d         CDS       T00163                                 

Gene name
psbL
Definition
(GenBank) photosystem II PsbL protein
  KO
K02713  photosystem II PsbL protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0375_d (psbL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0375_d (psbL)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    syc0375_d (psbL)
SSDB
Motif
Pfam: PsbL Tail_VII
Other DBs
NCBI-ProteinID: BAD78565
CyanoBase: syc0375_d
CYORF: syc0375_d
UniProt: Q5N554
Position
411260..411385
AA seq 41 aa
MPTRSTNPNKQPVELNRTSLFLGLLLVFVLGILSPATSLTS
NT seq 126 nt   +upstreamnt  +downstreamnt
atgcctacgcgctcgactaaccccaataagcagccggttgaactcaaccggacttcactg
ttcttgggcttgctgcttgtttttgtcctggggattctttctccagctacttctttaact
agctag

DBGET integrated database retrieval system