KEGG   Synechococcus elongatus PCC6301: syc0376_d
Entry
syc0376_d         CDS       T00163                                 

Gene name
psbJ
Definition
(GenBank) photosystem II PsbJ protein
  KO
K02711  photosystem II PsbJ protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0376_d (psbJ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0376_d (psbJ)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    syc0376_d (psbJ)
SSDB
Motif
Pfam: PsbJ
Other DBs
NCBI-ProteinID: BAD78566
CyanoBase: syc0376_d
CYORF: syc0376_d
UniProt: Q5N553
Position
411462..411581
AA seq 39 aa
MAGGGRIPLWIVATVAGTGALVVVGLFFYGAYAGLGSSL
NT seq 120 nt   +upstreamnt  +downstreamnt
gtggctggtggtggacgtattcccctctggatcgttgcaacggtagcaggcaccggggcg
ctcgtcgttgtaggtctctttttctacggcgcttacgcaggtctgggctcgtctctctag

DBGET integrated database retrieval system