KEGG   Synechococcus elongatus PCC6301: syc0493_c
Entry
syc0493_c         CDS       T00163                                 

Gene name
cpcF
Definition
(GenBank) phycocyanin alpha-subunit phycocyanobilin lyase
  KO
K02289  phycocyanobilin lyase subunit beta [EC:4.4.1.32]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00196  Photosynthesis - antenna proteins
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    syc0493_c (cpcF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0493_c (cpcF)
Enzymes [BR:syc01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.32  C-phycocyanin alpha-cysteine-84 phycocyanobilin lyase
     syc0493_c (cpcF)
Photosynthesis proteins [BR:syc00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    syc0493_c (cpcF)
SSDB
Motif
Pfam: HEAT_2 HEAT_PBS HEAT DUF4042 DBR1
Other DBs
NCBI-ProteinID: BAD78683
CyanoBase: syc0493_c
CYORF: syc0493_c
UniProt: A0A0H3K3J9
Position
complement(554125..554748)
AA seq 207 aa
MSTELIAAVEAADSAEGLVRAVAALSAARTDAAIPTLISVLAFNNPGAAVVAVDGLIQLG
SPAAQAILNNLDDYNYGARAWALRALAGIGEPAALPLLLSAAREDFSLSVRRAATYGLGR
VRWADLSESDRLAQQQQCYETLKLCLQYDPEWVVRYAAAAALETLAPAATQLQSAIAETL
NRQAHSDEERAVQARSRLAERRLAGGV
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagcacggaattgatcgctgctgttgaagccgctgattcggcggaaggactggtgcgg
gcggtagcggcactgtcggcggctcgtactgatgcggctatcccgactttgattagcgtt
ttagcgttcaacaacccaggggctgcggtggttgcggtcgatggtctgattcaactgggt
tctccagcggcacaagccattctcaataatctggatgactataactacggcgcaagagct
tgggctctgcgcgccttagctggcattggagaaccggcagccctgcccctgctcctgtca
gcggcgcgggaagatttttcgctcagtgtgcggcgggcggcgacttacggcttggggcga
gtgcgctgggcagatctgtccgagagcgatcgccttgcccaacaacagcagtgctatgaa
accctgaagctctgccttcagtacgatccggaatgggtggtgcgctatgcagcagcagcg
gcactggaaaccttagctccggctgcaacccagctccagtctgcgattgcagaaactctc
aaccggcaggctcacagcgatgaggaacgagccgttcaggcgcgatcgcgtttagccgag
cgacgcctagccggtggtgtataa

DBGET integrated database retrieval system