KEGG   Synechococcus elongatus PCC6301: syc0495_c
Entry
syc0495_c         CDS       T00163                                 

Gene name
cpcA
Definition
(GenBank) phycocyanin alpha subunit
  KO
K02284  phycocyanin alpha chain
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00196  Photosynthesis - antenna proteins
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    syc0495_c (cpcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0495_c (cpcA)
Photosynthesis proteins [BR:syc00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    syc0495_c (cpcA)
SSDB
Motif
Pfam: Phycobilisome
Other DBs
NCBI-ProteinID: BAD78685
CyanoBase: syc0495_c
CYORF: syc0495_c
UniProt: P00308
Structure
PDB: 
4H0M

Position
complement(555667..556158)
AA seq 163 aa
MSKTPLTEAVAAADSQGRFLSSTELQVAFGRFRQAASGLAAAKALANNADSLVNGAANAV
YSKFPYTTSTPGNNFASTPEGKAKCARDIGYYLRIVTYALVAGGTGPIDEYLLAGLDEIN
KTFDLAPSWYVEALKYIKANHGLSGDSRDEANSYIDYLINALS
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtccaagactcctctgaccgaagctgtcgctgctgctgattcgcaagggcgttttctg
agcagcactgaactgcaagttgcatttggtcgtttccgtcaagctgcttctggtttggca
gcggctaaggcgttggcaaacaatgctgacagcttggtcaacggtgcagcgaacgctgtt
tacagcaagttcccctacaccaccagcacgcctggcaacaactttgcatcgacgccggaa
ggcaaagcgaagtgtgcgcgtgacattggttactatctgcggattgtgacctatgcattg
gttgcgggtggcacgggtccgattgatgagtacctgttggcaggtcttgatgagatcaac
aagaccttcgacttggcgccgagctggtatgtggaagcgctgaagtacatcaaagcgaat
catggcttgagtggtgactctcgcgatgaagccaactcctacatcgactacctcatcaat
gccctcagctag

DBGET integrated database retrieval system