KEGG   Synechococcus elongatus PCC6301: syc0497_c
Entry
syc0497_c         CDS       T00163                                 

Gene name
cpcD
Definition
(GenBank) phycocyanin linker protein 9K
  KO
K02287  phycocyanin-associated, rod
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00196  Photosynthesis - antenna proteins
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    syc0497_c (cpcD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0497_c (cpcD)
Photosynthesis proteins [BR:syc00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    syc0497_c (cpcD)
SSDB
Motif
Pfam: CpcD
Other DBs
NCBI-ProteinID: BAD78687
CyanoBase: syc0497_c
CYORF: syc0497_c
UniProt: Q44114
Position
complement(557241..557486)
AA seq 81 aa
MLGQSALVGARSGAVASRVFVYEVEGLHQSDQTDLNRYPVRQSGTVQFKVPYARMNEELR
RINRLGARIVSIKPLTAEAED
NT seq 246 nt   +upstreamnt  +downstreamnt
atgttgggtcaatctgctttggtcggcgcccgtagtggtgccgtcgctagtcgagtcttt
gtctacgaagttgaaggccttcatcaaagtgatcagaccgatctgaatcgctaccccgtg
cgccagagtggcacggttcaattcaaggtgccctacgcacgcatgaacgaagaattgcgt
cgcatcaatcgtttgggtgcccgtattgtcagcattaagccactcacggctgaagctgaa
gactag

DBGET integrated database retrieval system