KEGG   Synechococcus elongatus PCC6301: syc0498_c
Entry
syc0498_c         CDS       T00163                                 

Gene name
cpcC
Definition
(GenBank) phycobilisome rod linker polypeptide
  KO
K02286  phycocyanin-associated rod linker protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00196  Photosynthesis - antenna proteins
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    syc0498_c (cpcC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0498_c (cpcC)
Photosynthesis proteins [BR:syc00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    syc0498_c (cpcC)
SSDB
Motif
Pfam: PBS_linker_poly CpcD
Other DBs
NCBI-ProteinID: BAD78688
CyanoBase: syc0498_c
CYORF: syc0498_c
UniProt: A0A0H3K0E9
Position
complement(557578..558447)
AA seq 289 aa
MAITVASSRLGTAPFSNAAPVELRPDGDRDQVQAVIRAVYRQVLGNDYIMKSERLTAAES
LLVNGSISVRDFVRAVAKSELYKTKFFYNNFQTRVIELHCKHLLGRAPYSEAEVIEHLDR
YETQGYDADVDSYIDSSEYLETFGESIVPYYRDIEYHVGQQSVGLPRLFSLYRGYATSDR
TSLGGNNSRLAANLAAKSVAPVVAPSVGTNYVASTKGEAPMRALGGSTPFGQTASRIFRV
EIAAISKPGFPSVRRSNRSLLVPYEQLNNTLQQVNRSGGRVVSVAPASL
NT seq 870 nt   +upstreamnt  +downstreamnt
atggcaattactgttgcatcctctcgtctcggaacagcaccgttcagcaatgctgcaccg
gttgagctgcgtcctgatggcgatcgcgaccaagtacaagcggtaatccgcgcggtttac
cgccaagtgcttggcaacgactacatcatgaagtcggagcgcttgacggccgctgaatcc
ttgctggtcaatggctcgatttccgtgcgcgactttgtccgtgctgtggctaagtcagag
ttgtacaagaccaagttcttctacaacaacttccaaacccgtgtcattgagttgcactgc
aaacatctgttgggtcgtgcaccctatagcgaggccgaagtgatcgagcacctcgatcgc
tacgaaacccaaggctacgacgcagatgtcgactcctacatcgattcttcggagtacttg
gaaaccttcggcgaaagcatcgttccctactaccgagacattgagtaccacgtcggtcag
cagagcgtcggtctgccgcgcctgttctcgctctaccggggctatgctacgagcgatcgc
acctccttgggcggtaacaattctcgcctagcggcaaacttggcggccaaatccgtggca
ccggtcgtggcccccagcgttggcaccaactacgttgcttcgaccaagggtgaagccccg
atgcgggccttgggtggctcgacgccctttggccaaacggccagccggatcttccgcgtt
gaaatcgcggcgattagcaaaccgggcttccccagcgtgcgccgcagtaatcgctcgctc
ctggtgccctacgagcaactgaacaacaccttgcaacaggtcaaccgcagcggcggtcgt
gttgtcagcgtggcgccggctagcctctag

DBGET integrated database retrieval system