KEGG   Synechococcus elongatus PCC6301: syc0499_c
Entry
syc0499_c         CDS       T00163                                 

Gene name
cpcC
Definition
(GenBank) phycobilisome rod linker polypeptide
  KO
K02286  phycocyanin-associated rod linker protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00196  Photosynthesis - antenna proteins
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    syc0499_c (cpcC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0499_c (cpcC)
Photosynthesis proteins [BR:syc00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    syc0499_c (cpcC)
SSDB
Motif
Pfam: PBS_linker_poly CpcD VipB
Other DBs
NCBI-ProteinID: BAD78689
CyanoBase: syc0499_c
CYORF: syc0499_c
UniProt: A0A0H3K087
Structure
PDB: 
2L3W

Position
complement(558495..559316)
AA seq 273 aa
MTSLEAARRLGFSAYSESAPLEWRAGASSDEINAIIRAVYRQVLGNDYVMGTERLTSAES
LLRGGEISVRDFVRAVALSELYREKFFHNNAHNRFIELNFKHLLGRAPYDQAEVAAHAAT
YHSHGYDADINSYIDSAEYTESFGDNVVPYFRGFATIRAQKTVGFNRIFQLYRGYATSDR
SATSQRSRLDQEVARNAASPVLIGSTDSALVGTCGGSRDQLFRVQVQQQGVTARTSNRIR
RSNATYFVSYEKLNATLQRVHAQGGRIVSITPA
NT seq 822 nt   +upstreamnt  +downstreamnt
atgacgagtcttgaagcagcccgtcgtctcggattctcggcctatagtgagtcagctcct
ttagaatggcgtgcgggtgcatcttcggatgaaatcaacgccatcattcgcgctgtctat
cgacaagtgctgggcaatgattacgtcatgggcaccgagcgcttgaccagtgccgaatct
ttgctgcgcggtggtgaaatttcggttcgtgattttgttcgggcagttgctctttccgaa
ctgtatcgcgaaaaattcttccataacaatgctcacaatcgattcattgagctgaacttt
aaacacctgctgggtcgtgctccctacgatcaagctgaagttgctgcccatgctgcgact
tatcacagtcacggctatgacgcagatatcaattcctacattgattctgctgaatacacc
gaaagctttggggataatgtcgttccttacttccggggttttgcaacgattcgggctcaa
aaaacggttggtttcaaccgcatttttcagctctatcgcggctatgcaacgagcgatcgc
tcagccaccagccagcgatcgcggctcgatcaagaagtggcacgcaatgcagcgtcacca
gtgttgatcggctcgacggatagtgctcttgtcggcacctgtggcggaagccgtgatcag
cttttccgcgttcaagtacagcagcaaggcgtgacggctcgcacttcgaatcggattcgt
cgtagcaacgctacctacttcgtgtcctacgaaaagctgaatgcaactctgcaacgggtt
catgcccaaggtggccgcatcgtcagcatcactccagcctag

DBGET integrated database retrieval system