KEGG   Synechococcus elongatus PCC6301: syc0543_c
Entry
syc0543_c         CDS       T00163                                 

Gene name
psaD
Definition
(GenBank) photosystem I reaction center subunit II
  KO
K02692  photosystem I subunit II
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00163  Photosystem I
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0543_c (psaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0543_c (psaD)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Main subunits
    syc0543_c (psaD)
SSDB
Motif
Pfam: PsaD DUF2890
Other DBs
NCBI-ProteinID: BAD78733
CyanoBase: syc0543_c
CYORF: syc0543_c
UniProt: P23076
Position
complement(606592..606918)
AA seq 108 aa
MAETLTGKTPVFGGSTGGLLKSAETEEKYAITWTSTKEQVFELPTGGAAVMHEGDNLLYF
ARKEQALALVPSFAPSSNPRSKATKSIASSPARMWDTSIRKMVSSLRK
NT seq 327 nt   +upstreamnt  +downstreamnt
atggccgagacactgactgggaaaacgccggtttttggcggtagcactggtggtctactc
aagagcgcagagaccgaagaaaaatacgccatcacttggaccagcaccaaagaacaggtg
tttgagctgccgaccggtggcgctgccgtgatgcacgaaggcgataacttgctctacttt
gcgcgcaaagagcaagcactcgcattggtacccagcttcgcaccaagttcaaacccaaga
tcgaaagctacaaaatctatcgcttcttccccggcgcggatgtgggatacctccatccga
aagatggtgtcttccctgagaaagtga

DBGET integrated database retrieval system