KEGG   Synechococcus elongatus PCC6301: syc0622_d
Entry
syc0622_d         CDS       T00163                                 

Gene name
psaK
Definition
(GenBank) photosystem I reaction center subunit X
  KO
K02698  photosystem I subunit X
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0622_d (psaK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0622_d (psaK)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Other common subunits
    syc0622_d (psaK)
SSDB
Motif
Pfam: PSI_PSAK
Other DBs
NCBI-ProteinID: BAD78812
CyanoBase: syc0622_d
CYORF: syc0622_d
UniProt: A0A0H3K0Q1
Position
693832..694086
AA seq 84 aa
MLPVLAAIPQTVAWSPKVALVMILSNIVAIAIGKATIKIQNAGPALPSPQLFGGFGLPAV
LATASFGHILGIGVILGLANIGNL
NT seq 255 nt   +upstreamnt  +downstreamnt
atgctgccggttttagctgcaattccccaaactgttgcttggagcccgaaagtggctcta
gtgatgattctgagcaacatcgtggcgatcgccattggcaaggccactatcaagattcag
aatgctggtccggctttgccttcgccccaactttttgggggtttcggtctgcctgcagtc
ctcgcgaccgctagcttcggtcacattttgggcattggcgtcatcctcggcttggccaac
atcggcaatctctaa

DBGET integrated database retrieval system