KEGG   Synechococcus elongatus PCC6301: syc0831_c
Entry
syc0831_c         CDS       T00163                                 

Gene name
psbM
Definition
(GenBank) photosystem II PsbM protein
  KO
K02714  photosystem II PsbM protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0831_c (psbM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0831_c (psbM)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    syc0831_c (psbM)
SSDB
Motif
Pfam: PsbM TMEM154
Other DBs
NCBI-ProteinID: BAD79021
CyanoBase: syc0831_c
CYORF: syc0831_c
UniProt: Q5N3U9
Position
complement(929144..929251)
AA seq 35 aa
MQVNELGFLASLLFVLVPSVFLIVLYIQTASREAK
NT seq 108 nt   +upstreamnt  +downstreamnt
atgcaagtcaacgagcttgggttccttgccagtctgctgtttgtgctcgtgccgagcgtc
tttttgatcgtcctgtacatccagacggcaagccgcgaagcgaaataa

DBGET integrated database retrieval system