KEGG   Synechococcus elongatus PCC6301: syc0833_d
Entry
syc0833_d         CDS       T00163                                 

Gene name
psbB
Definition
(GenBank) photosystem II core light harvesting protein
  KO
K02704  photosystem II CP47 chlorophyll apoprotein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00161  Photosystem II
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0833_d (psbB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0833_d (psbB)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    syc0833_d (psbB)
SSDB
Motif
Pfam: PSII DUF1211
Other DBs
NCBI-ProteinID: BAD79023
CyanoBase: syc0833_d
CYORF: syc0833_d
UniProt: A0A0H3K7H2
Position
930122..931648
AA seq 508 aa
MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYELAIFDPSDAVLNPMWRQGM
FVLPFMARLGVTQSWGGWSITGETAVDPGYWSFEGVAIAHIVLSGLLFLAAVWHWVYWDL
ELFTDPRTGEPALDLPKMFGIHLFLSGLLCFGFGAFHLSGLWGPGMWVSDPYGLTGHVQP
VAPAWGPEGFNPFNPGGIVAHHIAAGVVGIVAGLFHLTVRPPERLYKALRMGNIETVLSS
SLAAVFFAAFVVAGTMWYGNAATPVELFGPTRYQWDQGYFRQEIARRVDTAVASGASLEE
AWSSIPEKLAFYDYVGNSPAKGGLFRTGQMNKGDGIAQGWLGHAVFKDKNGDVLDVRRLP
NFFENFPIVLTDSKGAVRADIPFRRAEAKFSFEETGITASFYGGSLNGQTITDPAQVKKY
ARKAQLGEAFEFDTETLNSDGVFRTSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA
GIEADLGEQIEFGAFQKLGDPTTRKTAA
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgggactaccctggtaccgtgtccacacggtcgtcctcaatgatccgggacgactgatt
gcagtgcacttgatgcacactgccctcgtggcaggttgggcaggttcgatggctttatac
gaacttgccatttttgatccttctgatgccgtgctgaaccccatgtggcggcaaggcatg
ttcgtgttgccgttcatggcgcgtttgggcgtcacccaatcttggggtggctggagcatc
accggcgaaaccgccgtggatcctggctattggagctttgaaggcgtcgcgatcgcccac
atcgtactgtcgggtctgctgttcctcgcagcagtctggcactgggtctactgggacctc
gaactctttaccgatccccgcaccggcgaaccggccttggacctgccaaaaatgtttggc
atccacctgttcctctccggtcttctttgcttcggcttcggtgctttccacctgtctggc
ctctggggcccggggatgtgggtctccgatccctacggcttgaccggccatgtccaacca
gttgccccggcctggggtcctgaaggcttcaaccccttcaatccgggtggcattgtggct
caccacattgcagccggtgtcgttggcatcgtcgcaggcctcttccacctgacggttcgt
ccccccgagcgcctctacaaagcgctgcggatgggcaacatcgaaaccgtcttgtcgagc
tccttggcagcagtcttcttcgctgcttttgtggtcgctggcacgatgtggtacggcaac
gctgccacgccagtcgaactgtttggcccaactcgctaccagtgggaccaaggctacttc
cgtcaggaaattgcccgccgggttgatacggctgtcgccagtggcgcttctttagaggaa
gcttggagctccattcctgaaaaactggccttctatgactacgtcggcaacagccctgct
aaaggtggcttgttccgtaccggtcagatgaacaaaggtgacgggattgcccaaggctgg
ctcggccacgctgtcttcaaggacaaaaatggcgatgtgctcgacgtccgtcgcttgccg
aacttcttcgagaacttcccgatcgtcttgactgacagcaaaggtgctgtgcgggcagac
attcctttccgtcgtgctgaagcgaaattcagcttcgaggaaaccggaattacggctagc
ttctacggcggttctctgaatggccaaaccatcactgatccggcgcaggtgaagaaatac
gcccgtaaggctcagttgggtgaagcgttcgaattcgacaccgaaacccttaactcggac
ggtgtgttccggacttcgccgcgtggctggttcacctttggtcacgccagctttgctctg
ctcttcttctttggccatatctggcacggctctcggacgctgttccgcgatgtctttgct
gggattgaagccgacttgggcgagcagattgaattcggggccttccagaaattgggtgac
ccgaccactcggaaaacagccgcttaa

DBGET integrated database retrieval system