KEGG   Synechococcus elongatus PCC6301: syc0872_c
Entry
syc0872_c         CDS       T00163                                 

Gene name
psbC
Definition
(GenBank) photosystem II CP43 protein
  KO
K02705  photosystem II CP43 chlorophyll apoprotein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00161  Photosystem II
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0872_c (psbC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0872_c (psbC)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    syc0872_c (psbC)
SSDB
Motif
Pfam: PSII
Other DBs
NCBI-ProteinID: BAD79062
CyanoBase: syc0872_c
CYORF: syc0872_c
UniProt: A0A0H3K247
Position
complement(968212..969597)
AA seq 461 aa
MVTLSSPSVIAGGRDIDSTGYAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFEV
AHFVPEKPMYEQGIILLSHLATLGWGVGPGGEVVDTFPYFVVGVLHLISSAVLGLGGIYH
ALRGPESLEEYSTFFSQDWKDKNQMTNIIGYHLILLGLGAFLLVFKAMFFGGVYDTWAPG
GGDVRIISNPTLNPAVIFGYLLKSPFGGDGWIVSVDNLEDVIGGHIWIGLICISGGIWHI
LTKPFGWVRRAFIWNGEAYLSYSLGALSLMGFIASTMVWYNNTVYPSEFFGPTAAEASQS
QAFTFLVRDQRLGANIGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGP
NGLDLDKLTNDIQPWQARRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRAWSATSHFV
LAFFFLVGHLWHAGRARAAAAGFEKGIDRATEPVLAMRDLD
NT seq 1386 nt   +upstreamnt  +downstreamnt
gtggtaacgctctctagtccttccgtgatcgcaggcggccgggatattgactccaccggt
tacgcttggtggtccggcaatgcccgtttgatcaacctgtccggtaagctgctgggcgct
cacgtcgctcatgctggcttgatcgtcttctgggctggtgcgatgacgctgtttgaagtc
gcgcactttgtccccgaaaaaccgatgtacgagcaaggcatcatcctgctctcgcacttg
gcgaccctcggctggggcgttggccctggtggcgaagtcgtcgataccttcccctacttt
gtggttggggttctgcacctcatttcttccgccgttctgggtttgggtgggatctaccac
gccctgcgcggccctgagtcgctggaagagtacagcaccttcttcagccaagactggaaa
gacaagaatcagatgaccaacatcattggttatcacctgattctgctgggcttaggtgcc
ttcttgctggtctttaaggccatgttcttcggcggtgtctatgacacctgggcgccgggt
ggtggcgatgtccgcatcatctccaacccaaccctcaacccggctgtgatcttcggctac
ctgctgaaatcaccctttggtggcgacggctggattgtcagcgtcgacaaccttgaagac
gtgattggcggccatatctggattggtctgatctgcatttcgggtggtatctggcacatc
ctgaccaagccttttggctgggtgcgtcgcgccttcatctggaatggcgaagcttacctc
tcctacagcttgggtgccctgtcgttgatgggcttcattgcctcgacgatggtttggtac
aacaacaccgtctatccttccgagttctttggcccgaccgctgctgaagcttcgcaatcg
caagccttcaccttcttggtgcgtgaccaacgcctcggtgccaacatcggttcagctcaa
ggcccgaccggtctgggtaaatacctgatgcgctctcctaccggcgagatcatcttcggt
ggcgaaaccatgcgcttctgggacttccgtggcccttggctggagcccctgcgtggaccg
aatggtctggatctcgacaagctgaccaatgacattcagccttggcaagcccgtcgtgcg
gctgagtacatgacccacgcaccgctgggttcgctgaactctgtgggtggtgtggcaacg
gaaatcaactcggtgaacttcgtgtctccccgtgcttggtcggcgaccagccacttcgtc
ttggccttcttcttcttggtcggtcacctctggcatgcaggccgcgctcgtgcagctgct
gcaggctttgagaaaggtatcgatcgcgcgaccgaacccgtgctcgcaatgagagacctc
gactaa

DBGET integrated database retrieval system