KEGG   Synechococcus elongatus PCC6301: syc0986_d
Entry
syc0986_d         CDS       T00163                                 

Gene name
psaC
Definition
(GenBank) photosystem I iron-sulfur center subunit VII
  KO
K02691  photosystem I subunit VII
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00163  Photosystem I
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc0986_d (psaC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc0986_d (psaC)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Main subunits
    syc0986_d (psaC)
SSDB
Motif
Pfam: Fer4 Fer4_7 Fer4_4 Fer4_9 Fer4_6 Fer4_10 Fer4_21 Fer4_17 Fer4_16 Fer4_2 Fer4_22 Fer4_3 Fer4_8 Fer4_13 Fer4_18 ETF_QO Fer4_15
Other DBs
NCBI-ProteinID: BAD79176
CyanoBase: syc0986_d
CYORF: syc0986_d
UniProt: P31085
Structure
PDB: 
1JB0

Position
1101547..1101792
AA seq 81 aa
MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIAASPRTEDCVGCKRCETACPT
DFLSIRVYLGAETTRSMGLAY
NT seq 246 nt   +upstreamnt  +downstreamnt
atgtctcattcggtcaagatttacgacacttgcatcggctgcacccagtgcgtgcgggcg
tgccctctcgatgtactggaaatggtgccctgggacggctgtaaagccggtcagatcgct
gcttctccgcgaaccgaagattgtgtgggctgtaagcgttgcgaaacggcttgccccacg
gactttttgagcattcgggtctacctgggtgccgaaacgacgcgcagcatgggtctggct
tactaa

DBGET integrated database retrieval system