KEGG   Synechococcus elongatus PCC6301: syc1022_cHelp
Entry
syc1022_c         CDS       T00163                                 

Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00051  Fructose and mannose metabolism
syc00520  Amino sugar and nucleotide sugar metabolism
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    syc1022_c
   00520 Amino sugar and nucleotide sugar metabolism
    syc1022_c
Enzymes [BR:syc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     syc1022_c
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     syc1022_c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase PGM_PMM_I Hexapep NTP_transf_3 PGM_PMM_II PGM_PMM_III Hexapep_2 Bactofilin DUF4954
Motif
Other DBs
NCBI-ProteinID: BAD79212
CyanoBase: syc1022_c
CYORF: syc1022_c
UniProt: A0A0H3K880
Position
complement(1133782..1136295)
Genome map
AA seq 837 aa AA seqDB search
MRAVLLAGGLGTRLRPLTCDRPKPMVPILNRPIAAHILQLLHRHGYQEILATLYYRPETI
QQYFQEGQDWGVDLRYILEADRPLGTAGSVKNLTSQLQETFLVASGDCLSDFDLTAALAW
HRQQQAIATVILARVDQPLEFGCVVCDRQQRIIRLIEKPDASELISDTVNSGFYILEPEA
LDYLPLDEPSDFATHLLPRLLAAGEVVTGYVDQGYWCDIGNRQAYQRAQLDALLGRVRLQ
ANQMEWRPGIYVGEGTTIASSAQLEPPLWIGQHCYIGEEVQLKAGTVIGDESRIEAGACL
DRAVVWNRVQIGQRSHLEGCVLADGVRLERHVQIHEGAVIGSGCRLQEEAQVQAEVRIWP
RKQIEAGAIVNLNLIWATSARRRLFSDGGVRGIANVDITPEFAVKLGVAYGSTIPPGSSV
TVSRDQRSISQMVTRSLIAGLMSTGITIRNLEAAAVPIARSMLARLPVVGGIHVRLDPLW
PTHVLIEFLDREGLTVDRALERRIEAAFFQEDLRRVPMQDLGTMITVSETLPLYRQLFCD
RLDRDLLLRSPNRIVIDYAYSVSGAVLPLLLSEFGCDAVILNASLRQQPPTENERQSLLE
QMGQVVSAIKANCGVQVAANGERFTLVDEQGMALDHEQLTVLMAEICWLRRPGGTVVVPM
TSSSAVDQTAWRYHGRVHRCRPTPTALMAACRNLPDVILGGSGELGFIFPEMHAGFDAIF
GIARLIEGLDRQSRSLSQWVESLPSIAHRHLTLSCPRNLLGTLMRQLLESHEPDRLNFQE
GLRIQGDRGDQWLLVLPDASYPLIHLYANAQDHQWVEQTLGSYQQQIEQFVATLQSP
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctgttttactcgcgggtggactgggaacgcggttacgacccttgacctgcgat
cgccccaaaccgatggtgccgatcctcaatcgcccgatcgcggcccatattctgcaactg
ctgcaccgccatggttatcaagaaattctggcaacgctctactatcgccccgagacgatc
cagcagtacttccaagagggacaggactggggggttgacctgcgctacatcctcgaagcc
gatcgccccttggggacggcgggcagcgtcaaaaacctgactagtcaactgcaggagacc
tttcttgttgccagtggcgactgcctgagcgactttgatctgacagcagcgttggcttgg
catcgccaacagcaagcgatcgcgacggtgattttggctcgggtggatcagcctcttgaa
tttggttgcgttgtctgcgatcgccagcaacgaattatccgtctgattgaaaaaccagat
gccagtgaactaatttctgacaccgtcaacagcggcttttacattcttgaacccgaagcc
ctggactatctgcccctggatgagccctcagactttgctacccatcttctaccgcgtctt
ttggctgccggagaagtagtaacgggctacgtcgatcagggctactggtgtgatatcggt
aaccgtcaggcctatcaacgggcgcagctcgatgctttgctggggcgggtgcgactgcaa
gccaatcaaatggagtggcggcccggtatctatgttggtgagggcaccacgatcgccagt
agtgcgcagctagaaccccccctttggattggtcagcactgttacatcggcgaggaggtg
cagctcaaagctggcacggtaatcggggatgaaagccggattgaggctggcgcttgcctc
gatcgtgcagtggtttggaatcgggtgcaaattgggcagcgatcgcacctcgagggctgt
gtgctggcggatggggtgcgtctggagcgccatgtgcaaattcatgagggtgcagtcatc
ggcagcggctgtcgtctccaagaagaagcacaggttcaggccgaagtgcggatttggccc
cgcaagcaaattgaagcaggcgcgatcgtcaacctcaatttgatttgggcaactagtgcc
cgccgtcgcctatttagtgatggcggtgtgcgcggtatcgccaacgtcgatatcacgccg
gagtttgccgtcaagttgggcgtcgcctacggctcaaccataccgcccggtagcagtgtc
acggtctcgcgcgaccagcgcagtatttcgcaaatggtgacgcgatctctgattgcaggc
ttgatgtccacgggcattacgattcgcaacctcgaagcggcagcagtgccgatcgctcgc
tcgatgctggcgcggttgccggtggtgggcggtatccatgtccgtctcgatccactctgg
cccacccatgtcctaatcgagtttttggatcgcgagggtttgaccgtcgatcgcgcctta
gaacggcggattgaagcggcgttctttcaggaggatttgcgccgtgtccccatgcaggat
ctcggcacgatgatcaccgtcagcgaaaccctgccgctctaccgccagttgttttgcgat
cgcctcgatcgcgacttgctgctgcgatcgcccaaccgaattgtgatcgactacgcctac
tccgtctcgggggcggttttgccgctcctgctgagtgagtttggctgcgatgccgtcatt
ctcaatgccagcctgcgccagcaaccgcccacagaaaacgaacgccagtctctattggag
cagatgggccaagttgtcagtgcgattaaggctaactgtggcgtgcaagtggcggccaat
ggtgagcgttttaccttggtcgatgagcagggaatggcgctggaccatgaacagctgacc
gttttgatggcagaaatctgttggttgcggcgaccgggaggcacagtggtggtgccgatg
accagttccagcgctgtagatcagactgcttggcgctatcacgggcgcgtgcatcgttgt
cgaccgactccgacggcattgatggctgcttgccgcaatctaccggatgtcatcctcggt
ggtagtggcgagttgggcttcatttttccagagatgcacgctggctttgatgccatattt
ggcattgctcggctgattgaaggactcgatcgccaatcgcgatcgctgtcccagtgggtg
gagtcactgccgagtattgcccatcgccacctaaccctgagctgcccgcgcaatttacta
gggaccctgatgcggcaactcctcgaaagccatgagcccgatcgcctcaactttcaggag
ggcttgcggattcagggcgatcgcggcgatcaatggctgctggtcttaccagacgccagc
tatccgctgatccatctctatgccaacgcccaagatcaccagtgggtggagcaaaccttg
ggcagttatcaacagcagatcgagcagttcgtagccacgctccaaagtccttga

DBGET integrated database retrieval system