KEGG   Synechococcus elongatus PCC6301: syc1062_c
Entry
syc1062_c         CDS       T00163                                 

Gene name
psbK
Definition
(GenBank) photosystem II PsbK protein
  KO
K02712  photosystem II PsbK protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1062_c (psbK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1062_c (psbK)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    syc1062_c (psbK)
SSDB
Motif
Pfam: PsbK
Other DBs
NCBI-ProteinID: BAD79252
CyanoBase: syc1062_c
CYORF: syc1062_c
UniProt: P14089
Position
complement(1175535..1175672)
AA seq 45 aa
MEAALLLAKLPEAYQIFDPLVDVLPVIPVFFLLLAFVWQAAVGFR
NT seq 138 nt   +upstreamnt  +downstreamnt
atggaagctgcattgctcttggcgaaattgccggaagcctaccaaatcttcgatcccttg
gtagacgtactgcctgtgattccggtgttcttcctcttgctcgccttcgtgtggcaagca
gcagtcggcttccgctaa

DBGET integrated database retrieval system