KEGG   Synechococcus elongatus PCC6301: syc1093_c
Entry
syc1093_c         CDS       T00163                                 

Gene name
psbAI
Definition
(GenBank) photosystem II D1 protein
  KO
K02703  photosystem II P680 reaction center D1 protein [EC:1.10.3.9]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00161  Photosystem II
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1093_c (psbAI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1093_c (psbAI)
Enzymes [BR:syc01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.9  photosystem II
     syc1093_c (psbAI)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    syc1093_c (psbAI)
SSDB
Motif
Pfam: Photo_RC
Other DBs
NCBI-ProteinID: BAD79283
CyanoBase: syc1093_c
CYORF: syc1093_c
UniProt: Q5N337
Position
complement(1205925..1207007)
AA seq 360 aa
MTSILREQRRDNVWDRFCEWVTSTDNRIYVGWFGVLMIPTLLTATICFIVAFIAAPPVDI
DGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFL
LGISCYMGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLIYPIGQGSFSDGMPLGISGTF
NFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTSMGISTMAFNLNGF
NFNQSVLDSQGKVINTWADVLNRANLGMEVMHERNAHNFPLDLAAGEATPVALTAPSIHG
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaccagcattcttcgcgagcaacgccgcgataacgtttgggatcggttttgtgagtgg
gtaaccagcaccgacaaccgcatctacgtgggttggttcggcgtgctgatgatccccact
ctgctgaccgccaccatctgcttcatcgttgcgttcattgcagcccctcccgtcgacatc
gacggcatccgtgagcccgttgccggctctctcatgtatggcaacaacatcatttccggc
gctgttgttccttccagcaacgccatcggcctgcatttctatccgatttgggaagccgct
agcctcgacgagtggctgtacaacggtggtccttaccaattagtggtcttccacttcttg
ctgggtatcagctgctacatgggtcgtcaatgggagctgtcgtaccgcctcggtatgcgc
ccttggatctgtgttgcatacagtgctccactctcggctgcttttgcagtgtttctgatc
tacccgatcggccaaggttcgttctcggacggcatgcccctgggtatcagcggcaccttc
aacttcatgttcgtgttccaagcagagcacaacattttgatgcaccccttccacatgctg
ggtgtggctggtgtgttcggtggttcgctgttctcggcaatgcacggttcgttggtgacc
agctcgctggtgcgtgagacgaccgagaccgagagccaaaactacggctacaaatttggt
caagaggaagagacctacaacatcgtggcagcccacggttacttcggtcgcttgatcttc
caatacgcatcgttcaacaacagccgttcgctgcacttcttcctgggtgcatggccggtc
gtgggcatctggtttacctccatgggcatcagcaccatggcgttcaacctgaatggtttc
aacttcaaccagtcggttttggatagccaaggcaaagtgatcaacacttgggcagatgtg
ttgaaccgtgccaacttgggcatggaagtgatgcacgagcgtaatgctcacaacttcccg
ctcgacttggcagcaggcgaagcgaccccggtcgctttgactgcgccttcaattcacggt
taa

DBGET integrated database retrieval system