KEGG   Synechococcus elongatus PCC6301: syc1170_c
Entry
syc1170_c         CDS       T00163                                 

Gene name
psb27
Definition
(GenBank) photosystem II 11 kD protein
  KO
K08902  photosystem II Psb27 protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1170_c (psb27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1170_c (psb27)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    syc1170_c (psb27)
SSDB
Motif
Pfam: PSII_Pbs27 PRODH Pilus_CpaD LemA
Other DBs
NCBI-ProteinID: BAD79360
CyanoBase: syc1170_c
CYORF: syc1170_c
UniProt: A0A0H3K302
Position
complement(1283827..1284234)
AA seq 135 aa
MPMARPLARLFAIVLVAVIGLTACTGGGDSAISGNYRQDTLAVVTSLRNAITLPDDAPEK
SAAQAEARQLINDFAARYRRDSRVSGLSSFTTMQTALNSLAGHYSSYPNRPVPEKLKKRL
EKEFRMVELALNREA
NT seq 408 nt   +upstreamnt  +downstreamnt
gtgcctatggcccgccctctcgcacgcctgtttgcgatcgtgctcgttgccgtgattggc
ttaacggcttgtactggtggtggtgattcagcaatcagcggcaactatcgtcaggacacc
ctcgccgtcgtgaccagcctgcgcaatgcaatcacgctacccgacgatgccccagaaaaa
agcgccgctcaagctgaggcgcgtcagctgatcaatgactttgctgcgcgttaccgtcgt
gatagtcgcgtttcgggtctgtcatccttcacgacgatgcaaacagccttgaatagcttg
gccggccactacagctcttatcccaatcgccctgtgccagagaagttgaaaaaacgcttg
gagaaagagttccgcatggtggagttggccctcaaccgcgaagcctaa

DBGET integrated database retrieval system