KEGG   Synechococcus elongatus PCC6301: syc1177_c
Entry
syc1177_c         CDS       T00163                                 

Gene name
atpA
Definition
(GenBank) ATP synthase A subunit
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00190  Oxidative phosphorylation
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    syc1177_c (atpA)
   00195 Photosynthesis
    syc1177_c (atpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1177_c (atpA)
Enzymes [BR:syc01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     syc1177_c (atpA)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     syc1177_c (atpA)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   syc1177_c (atpA)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N ATPase ATPase_2
Other DBs
NCBI-ProteinID: BAD79367
CyanoBase: syc1177_c
CYORF: syc1177_c
UniProt: P08449
Position
complement(1288487..1290004)
AA seq 505 aa
MVSIRPDEISSIIRQQIEQYSQDVKVENVGTVLQVGDGIARIYGLQQVMSGELVEFEDGT
TGIALNLEEDNVGAVLMGEGRNIQEGSTVKATGKIAQIPVGDALVGRVVSPLGAPLDGKG
EIAATENRLIESPAPGIIARRSVHEPMQTGITAIDAMIPIGRGQRELIIGDRQTGKTAIA
IDTILNQKGEDVICVYVAIGQKASSVANIIEVLRERGALDYTVVVAANASEPATLQYLAP
YAGAAIAEYFMYKGKATLVIYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLE
RAAKLSDALGGGSMTALPVIETQAGDVSAYIPTNVISITDGQIFLSSDLFNSGLRPAINV
GISVSRVGSAAQTKAIKKIAGTLKLELAQFDELAAFAQFASDLDKATQNQLARGQRLREL
LKQPQFSPLILAEQVAVVYAGVKGLIDEIPVNQVTAFVSELRSYLKTSKPEFIEKVQSSK
QLDDAAEALLKEAIAEVKKNILAAV
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggttagcatcagacccgacgaaattagcagcatcattcgtcagcagattgagcagtac
agccaagacgtcaaagttgaaaacgtcggtaccgttctgcaggtgggtgacggcattgcc
cgcatctatggtctgcagcaggtgatgtctggcgagttggtggagttcgaagatggcacc
accggcatcgcgctcaacttggaagaagacaacgtcggtgcggtgttgatgggcgaaggc
cgcaacatccaagagggcagcacggttaaagcgaccggcaaaatcgctcagattccggtc
ggtgatgcactggttggccgtgtggtcagccccttgggtgcgccgttggacggcaaaggt
gaaattgcggcaaccgaaaatcgcctgatcgaatcgccggctcctggcatcattgcgcgt
cgctcggtgcatgagcccatgcagaccggtattaccgcgatcgacgcgatgattccgatc
ggccggggccagcgcgagctgatcatcggtgaccgtcagaccggcaaaaccgcaatcgcg
atcgacacgattctgaaccagaaaggcgaagacgtaatttgcgtctacgtcgcgatcggt
cagaaagcctcttcggttgccaacatcattgaagtcctgcgggaacgcggtgccctcgat
tacaccgtggtcgttgcggccaacgcttcagaaccggcaacgctgcaatacctggctccc
tacgccggtgctgcgatcgccgagtactttatgtacaaaggcaaagccaccttggtcatc
tacgatgacttgaccaagcaagcgcaggcttaccgccagatgtcgctgctgctgcgtcgt
ccgcccggtcgggaagcttaccccggcgatgttttctacctccacagccgtctgctggaa
cgcgccgctaaactgtcggacgctcttggtggtggcagcatgactgccctgccggtgatc
gaaacccaagccggtgacgtctcggcctacattccgaccaacgtgatctcgattacggac
ggtcaaatcttcctgtcctctgacctgttcaactcgggtctgcgtccggctattaacgtc
ggtatctcggttagccgggtcggttccgctgctcaaaccaaggcgatcaagaaaattgct
ggcacattgaagctggaattggctcagtttgatgagctggcggcctttgctcagtttgca
tctgacttggacaaagccactcaaaaccagttggctcgcggtcagcgtctgcgtgagctg
ctgaaacagcctcagttctcgccgttgattctggcggaacaagtagcagtggtctacgcc
ggtgttaaaggtctgatcgacgagattccggtcaaccaagtcacggccttcgtttctgag
ctgcgctcctacctgaagaccagcaagcctgagttcatcgagaaagttcaaagctcgaaa
caactcgatgacgccgctgaagcattgctgaaagaagcgatcgcggaagtgaagaaaaac
atcttggctgctgtctag

DBGET integrated database retrieval system