KEGG   Synechococcus elongatus PCC6301: syc1178_c
Entry
syc1178_c         CDS       T00163                                 

Gene name
atpD
Definition
(GenBank) ATP synthase d subunit
  KO
K02113  F-type H+-transporting ATPase subunit delta
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00190  Oxidative phosphorylation
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    syc1178_c (atpD)
   00195 Photosynthesis
    syc1178_c (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1178_c (atpD)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   syc1178_c (atpD)
SSDB
Motif
Pfam: OSCP DAD Herpes_BLRF2 DUF1539
Other DBs
NCBI-ProteinID: BAD79368
CyanoBase: syc1178_c
CYORF: syc1178_c
UniProt: P08448
Position
complement(1290051..1290593)
AA seq 180 aa
MTSTSQLFDPYAEALMAIAREQGLEDRFGEDAALFRSTLAASADLRHLLENPTLFSSQKK
AVLNQVFGSSVHPLVLNFLNLLVDRNRIAFLDGIADRYQALLRKLRNVVRADVSSAVPLT
EAQVQVITEKVKQLTGAAGVEIESQVDADLLGGVIIKVGSQVLDASLRGQLKRISISLAA
NT seq 543 nt   +upstreamnt  +downstreamnt
atgacgagcacttctcaactgtttgatccctacgcggaagccttgatggcgatcgctcgc
gaacaagggctagaggatcgctttggcgaggatgcagccctattccgaagcactttggct
gcttctgctgatctgcgccacctgttggaaaatccaaccttgttttccagccagaaaaaa
gcggttctcaaccaagtgtttggaagttcagttcatcccttggtcttgaacttcctcaat
ttgttagttgatcgcaatcgcatcgcctttttggacggcattgccgatcgctaccaggct
ctgctgcgtaagcttcgcaacgtggtacgagcagacgtctcttcagccgtgccgctgact
gaagcccaagtgcaagtgatcaccgaaaaggtgaaacaactcaccggcgcagcgggtgtg
gaaattgagagccaagtcgatgccgatcttttgggcggcgtcattatcaaagttggctct
caagtcctcgacgcaagtctgcggggccagctgaaacggatttcgatcagtttggccgcc
tag

DBGET integrated database retrieval system