KEGG   Synechococcus elongatus PCC6301: syc1179_c
Entry
syc1179_c         CDS       T00163                                 

Gene name
atpF
Definition
(GenBank) H+-transporting two-sector ATPase chain b
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00190  Oxidative phosphorylation
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    syc1179_c (atpF)
   00195 Photosynthesis
    syc1179_c (atpF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1179_c (atpF)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   syc1179_c (atpF)
SSDB
Motif
Pfam: ATP-synt_B V-ATPase_G_2 DUF885 LMBR1 DUF5082 PIN_8 Fmp27_WPPW
Other DBs
NCBI-ProteinID: BAD79369
CyanoBase: syc1179_c
CYORF: syc1179_c
UniProt: P08447
Position
complement(1290603..1291127)
AA seq 174 aa
MDSMSSWILLAHAETSGFGLNLDLFETNLINLAIIIGLLVYAGRGFLGNLLSNRRAAIEA
EIREVEEKLASSAQALSQAQTQLKEAEAEAARLLVEAKARAAAVRQEILDKAAADVERLK
ATAAQDVSTEQQRVLDELRRYAVAQALSRVETQLSQQLDEAAQQRLIDRSLATL
NT seq 525 nt   +upstreamnt  +downstreamnt
gtggatagtatgtcctcttggattttgctcgcgcatgctgagacctctgggttcggtctc
aatcttgatctctttgaaacgaacctgatcaacctggcgatcatcattggtctcttggtc
tatgcaggtcgaggtttcctcggcaatttgctcagcaaccgtcgcgctgcgatcgaagca
gaaatccgtgaggttgaagagaagctggcatcgtctgcccaagccctgagccaggctcag
acccaactgaaagaggcagaagctgaagcggctcgcctgttggttgaagccaaagcccgt
gcagcagcggtacgccaagaaattttggacaaagcagctgcggatgttgaacgcttgaaa
gccactgctgctcaagatgtcagcactgagcaacagcgtgtgctggacgaactgcgccgc
tatgcagttgcccaagccttgagccgggttgagacgcaactgtctcagcagttggatgag
gccgcccaacagcgcttgatcgatcgcagcttggctacgctctag

DBGET integrated database retrieval system