KEGG   Synechococcus elongatus PCC6301: syc1182_c
Entry
syc1182_c         CDS       T00163                                 

Gene name
atpI
Definition
(GenBank) ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00190  Oxidative phosphorylation
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    syc1182_c (atpI)
   00195 Photosynthesis
    syc1182_c (atpI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1182_c (atpI)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:syc03110]
    syc1182_c (atpI)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   syc1182_c (atpI)
Chaperones and folding catalysts [BR:syc03110]
 Other chaperones and cochaperones
  PapD
   syc1182_c (atpI)
SSDB
Motif
Pfam: ATP-synt_A
Other DBs
NCBI-ProteinID: BAD79372
CyanoBase: syc1182_c
CYORF: syc1182_c
UniProt: P08444
Position
complement(1292171..1292956)
AA seq 261 aa
MGSATLPSDLMSMPTLLELSSVLPLAELEVGQHFYWQIGNYRLHGQVFLTSWFVIAALVV
LSLLANRNLQRIPSGLQNFMEYVLDFIRNLARTQIGEKEYRPWVPFIGTLFLFIFLSNWS
GALIPWKLIKLPSGELAAPTSDINTTVALALLTSLAYFYAGFSRKGLGYFGNYVHPTPVM
LPFKILEDFTKPLSLSFRLFGNILADELVVAVLVLLVPLFVPLPAMILGLFTSAIQALIF
ATLAASYIGEAVEEHGEEHAE
NT seq 786 nt   +upstreamnt  +downstreamnt
atgggctccgcaacccttccttccgacctcatgtccatgccgactctactcgaactctcg
tcagttttgcctctcgccgagctcgaggtcggccagcatttttactggcagatcggcaac
tatcggcttcacggccaggtctttttgacttcttggttcgtgatcgcggccttggtggtg
ctgtctctcctggcgaatcgcaatcttcagcgcattcccagcggcctccagaatttcatg
gagtacgttctggacttcatccgtaacctagcccgcacccagatcggcgaaaaggaatat
cgtccttgggttccgtttattggtaccctgtttctgtttattttcctgtccaactggtcc
ggcgctctcatcccttggaagctgatcaagctcccttcgggcgaattggctgccccgacc
agtgacatcaacaccaccgtagcgctcgcgctattgacctcgctggcgtacttttacgcc
ggtttcagccgcaaagggctgggatattttggcaactacgtccatcccacgccggtgatg
ctgcccttcaaaattttggaggacttcaccaaacccttatccctgagcttccgtctgttt
ggaaacatcttggcagacgaacttgtggtggcggttctcgtgctgttggtgcctctcttc
gtgccgctgccagcaatgattctgggcttgtttaccagtgcgattcaagcgttgatcttt
gcaaccttggctgcgtcatacatcggcgaagccgtcgaagagcatggtgaggaacacgcc
gagtag

DBGET integrated database retrieval system