KEGG   Synechococcus elongatus PCC6301: syc1183_c
Entry
syc1183_c         CDS       T00163                                 

Gene name
atp1
Definition
(GenBank) ATP synthase protein I
  KO
K02116  ATP synthase protein I
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1183_c (atp1)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   syc1183_c (atp1)
SSDB
Motif
Pfam: AtpR ATP-synt_I Per1
Other DBs
NCBI-ProteinID: BAD79373
CyanoBase: syc1183_c
CYORF: syc1183_c
UniProt: P08443
Position
complement(1292982..1293338)
AA seq 118 aa
MAEYYALQRQLLQVTLICTVVIFGAVWWAYSLNTAASYLLGAMGGLLYLRMLGKAVERIG
ERRRQFGKSRLALFVVLIVLAARWQYLELMPVFLGFLTYKAALIWYTLRAVIPTAENS
NT seq 357 nt   +upstreamnt  +downstreamnt
atggcagagtactacgcgctgcagcgtcaactgttgcaggtcacgttaatttgcacagtc
gttattttcggagcggtctggtgggcctatagccttaacactgctgctagctatttgctg
ggggcaatgggtgggcttctctacctccggatgcttgggaaagcggttgagcggattggt
gagcgccgtcgccagtttgggaaatcacgtctagcgctcttcgtggtgctcattgtttta
gcagcacgatggcaatatctggaactgatgccggtctttttaggttttttgacctacaaa
gcagccctgatctggtacaccctgcgagctgtgatcccaactgctgaaaacagttga

DBGET integrated database retrieval system